KEGG   Pseudoalteromonas piscicida: B1L02_09680Help
Entry
B1L02_09680       CDS       T04942                                 

Definition
(GenBank) glucan 1,4-alpha-glucosidase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ppis  Pseudoalteromonas piscicida
Pathway
ppis00500  Starch and sucrose metabolism
ppis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B1L02_09680
Enzymes [BR:ppis01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     B1L02_09680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 TPR_6
Motif
Other DBs
NCBI-ProteinID: ASD67271
UniProt: A0A1Z3NIM4
LinkDB All DBs
Position
1:complement(2061058..2063454)
Genome map
AA seq 798 aa AA seqDB search
MIKLSTIALALVSAGLMGCGSQQSVNETLTAPGAPGVKPYWSYSGKAGIGTSYEAYEDGK
YSDSTATKAVSKVWFSVAKGMITETMFGLIHQAQIKDMQFIIVGDGFAVKESDTDALDIT
IDYLYKDASGRPLSLAYKIASKDKQGRFTLEKHIFTDPDGQTLFVRAKVDSDLTGVQAFV
NVNPYVNNNGLNDFAKVTEQGLLAWEGKNYLSLQSKTGFDEVSVGFTGTSDNLAALESTG
HIAQAYASTGKESGNVNWLASLGQVNGSSTFDLALSFGHSQQQSFAEGAATLAKGYDKVL
ADYNGQGGATGWQDYIESLAPLKSMTANTADNGKLLYTSALVLKAQEDKTHAGALIASLS
NPWGDTVPAERGQTGYKAVWVRDFYQVAMAFLAMGDTQTALTAFEYLEKVQVTDKTPGNH
GDTGWFLQKTHVDGELEWVGVQLDQTAMPIMLAWKLWQAGVLSDDKLVYWYNKMLKPAAN
FLVEGGLAKILWNDTQITPPATQQERWEEQNGYSPSTTAAIIAGLVTASDIAKLAGDKAG
QEKFLAAAQHYNRDVESFMFTTKGSLQSKHSDGQYFFRIGQDEDPNSSTTLNANNGRNGM
DKKQIIDGGFLELVRYGVRGADAPSIVATMPEYDDESIAENLRVKYSFKFDGDVNSYPGY
RRYGNDGYGEDEKRGINYAVNGNNTDGQRGRVWPFFTGERGHYDIALALLDGELSADEQS
KIQNTYVKGMEHFANEGMMLPEQVWDGVGKNTFGYKLGEGTNSATPLAWTHAEYVKLVRS
LNEKQVWDHYPIVESKLK
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgattaaactatcaacaatcgcacttgccttagtaagtgctggtctcatgggttgcgga
tcacagcaatctgtcaatgaaaccctgacggcaccaggtgcacctggtgttaaaccttat
tggtcatactctggaaaagcggggataggtacatcgtacgaagcctacgaagacggaaaa
tacagcgattctacggcgactaaagcggtttcaaaggtatggttttctgttgcaaaaggg
atgatcacagagaccatgtttgggcttatccaccaagcgcagatcaaagacatgcaattt
atcattgtgggtgatggttttgcggtgaaggaatccgataccgacgcgttagatatcacc
attgactatctttataaagatgctagtggacgacctttatcgctggcttacaaaattgca
agcaaggacaaacaaggtcgctttacccttgaaaagcatatttttaccgaccctgatgga
cagactttgtttgttagagcaaaagtagacagtgatctcacaggcgttcaggcttttgtg
aacgttaatccatacgtgaataacaatggcttaaacgattttgcgaaagtgacagagcaa
ggtttgttagcatgggaaggtaagaactatctctctttacagagcaaaaccggctttgat
gaagtatctgttggttttactggcaccagtgataatttagcggcacttgagtctacagga
catatagcccaagcttatgcgtctacaggcaaagagagtggtaacgttaactggctggca
agcttaggacaggtaaacggtagtagcacgttcgacctagccttgagttttggccactct
cagcagcaaagctttgctgagggggcagccacattagccaaaggttacgataaggtactg
gcagattataatggtcaagggggagcgacgggctggcaagattatatcgaaagtttagca
ccactaaaatccatgacggcaaataccgcggacaacggtaaattactttacactagtgcg
cttgtacttaaggcgcaagaagataaaacccatgcaggtgccttgatagcatcgttgtca
aacccatggggtgatacggtgccagcagagcgaggccaaaccggttataaggcggtatgg
gtgcgtgatttttatcaagtagcgatggcatttttggcgatgggagatacgcaaacggca
ctcactgcttttgagtatctagaaaaagtgcaagtgactgataaaacaccgggcaaccat
ggggatacaggctggttcctgcagaaaacgcatgttgatggcgagcttgaatgggttgga
gtgcagcttgaccaaacggcaatgccaatcatgctggcatggaaactctggcaagcaggt
gtgctaagcgatgataaactggtttattggtacaacaagatgttaaagcctgctgctaac
ttcttagttgaaggggggctggctaaaattttatggaacgacactcaaatcacgccgcct
gcgacacaacaagagcgttgggaagagcaaaatggttattcaccatcgactacagcggca
atcattgcaggcctcgtgacggcgagcgacattgcgaaattggccggtgataaagcggga
caagagaaattcctcgcggcggcgcagcattacaatcgagatgttgagtctttcatgttc
acaacaaaaggtagtctgcaaagcaaacacagtgacggtcaatatttcttccgtattgga
caagacgaagatcctaattccagtacgaccttaaatgccaataatggccgaaacgggatg
gataagaagcagatcatcgacggtggtttcttagaactcgtgcgttatggtgtcagaggt
gcggacgccccaagcattgtggctaccatgcctgaatacgatgatgagtcgatagctgaa
aatttaagagtaaaatatagctttaaatttgatggcgatgtaaatagttatccaggttac
cgccgttacggtaacgacggctatggtgaagatgagaagcgtggaatcaattatgccgta
aatggtaataataccgatggtcaacgtggtcgagtatggccgttctttaccggtgagcgt
ggtcattatgatattgcactggcgctgctcgatggtgaattaagtgctgatgagcagagc
aaaatacaaaatacttatgttaagggaatggaacactttgctaatgaaggcatgatgtta
cctgagcaagtatgggatggtgtgggtaaaaatacctttggctataaacttggcgaagga
accaattcggcgacgcctttagcttggacacacgctgagtatgtcaagttagtgcgctct
cttaatgaaaagcaggtttgggatcactacccaatcgtagaaagtaaactgaaataa

DBGET integrated database retrieval system