KEGG   Pseudoalteromonas piscicida: B1L02_10425Help
Entry
B1L02_10425       CDS       T04942                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ppis  Pseudoalteromonas piscicida
Brite
Enzymes [BR:ppis01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B1L02_10425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ASD68894
UniProt: A0A1Z3NN73
LinkDB All DBs
Position
1:2222866..2223447
Genome map
AA seq 193 aa AA seqDB search
MAFELPSLPYALNALEPHISQETLEFHHGKHHNTYVVKLNGLIEGTDFEGKSLEEIVCSS
EGGVFNNAAQIWNHTFYWHSLAPNAGGEPTGKVAELINAKWGSFAAFQEAFNDKAVNNFG
SSWTWLVQLADGSLDIVNTSNAATPLTEEGVTPIITVDLWEHAYYIDYRNVRPDYLKGFW
ALVNWDFANSNLA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaactaccgtcactaccttatgcactaaatgctcttgagccgcacatctct
caagagacactagagttccaccacggtaagcaccacaacacatacgttgtaaagctgaat
ggtcttattgaaggtactgactttgaaggtaaatcactagaagagatcgtatgtagctct
gaaggtggtgttttcaacaatgctgctcaaatctggaaccacaccttctactggcacagc
cttgcgccaaatgcaggtggtgaaccaacaggtaaagttgctgaactaattaatgcaaaa
tggggctcgttcgcagcattccaagaagctttcaacgacaaagcagttaacaactttggt
tcaagctggacttggttagtacaattagctgacggctctctagatatcgttaacacttca
aatgcagcaactccgctgactgaagaaggtgttacccctatcatcacagttgacctttgg
gaacatgcttactacattgattaccgtaatgttcgtcctgattacctaaaaggtttctgg
gcacttgttaactgggatttcgctaatagcaacctagcttaa

DBGET integrated database retrieval system