KEGG   Pseudoalteromonas piscicida: B1L02_14840Help
Entry
B1L02_14840       CDS       T04942                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppis  Pseudoalteromonas piscicida
Pathway
ppis00473  D-Alanine metabolism
ppis00550  Peptidoglycan biosynthesis
ppis01100  Metabolic pathways
ppis01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppis00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B1L02_14840
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B1L02_14840
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    B1L02_14840
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppis01011]
    B1L02_14840
Enzymes [BR:ppis01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B1L02_14840
Peptidoglycan biosynthesis and degradation proteins [BR:ppis01011]
 Precursor biosynthesis
  Amino acid ligase
   B1L02_14840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATP-grasp GARS_A
Motif
Other DBs
NCBI-ProteinID: ASD68164
UniProt: A0A3B6Y4S3
LinkDB All DBs
Position
1:complement(3199006..3199917)
Genome map
AA seq 303 aa AA seqDB search
MSSQFGKVAVLLGGSSAEREVSLKSGNAVLNAFVNQGVDAIAFDPAERNLWQLKDLGVDR
VFIALHGRGGEDGTIQGALEFMGIPYTGSGVLGSALAMDKVRCKHLFQSAKLSTAPYAVV
SKETGFDAKALIAEFGKVMVKPSHEGSSIGMAQADSEETLTAALNNAFKFDDQVLVEQWI
TGREFTVSMLGKEALPVIEMRTPRGFYDYEAKYQVNSTEYYCPADISAAHTEQLQVMAKH
AFELVGATGWGRVDAMQDEQGHFYLLEVNTVPGMTEKSLVPMAAKATGVSFEQLVVRILE
QTL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtcagtttggaaaagtagccgtattacttggcggtagttcagcagagcgagag
gtgtcgctaaagtctggtaatgcagtgttaaatgccttcgttaatcaaggcgttgatgca
atcgcttttgatcctgcagaacgtaatttatggcaacttaaagacctaggtgtggatcgc
gtattcattgcactgcatggccgtggcggtgaagatggtactattcaaggtgcgcttgag
tttatgggaataccatatacaggaagtggtgtacttggtagtgcgcttgcaatggataaa
gtccgctgtaagcatctatttcagtctgccaagttaagtacggcaccttatgctgtcgta
agtaaagagacggggtttgatgctaaggcgctgatagcagagtttggtaaagtcatggta
aagccaagccacgagggctcaagcataggtatggctcaggctgacagcgaagaaaccttg
actgcggcactcaataatgcttttaagtttgacgaccaagtcctcgttgaacaatggatc
actggacgtgagtttaccgtgtctatgctcggtaaagaggcattgcctgttattgaaatg
cgtacgcctcgtggtttttacgattatgaagcgaagtaccaagttaacagtacagagtat
tattgtccggcggatattagcgctgcacacactgagcaattacaagtgatggcaaagcac
gcttttgaattggttggtgccactggttggggacgtgttgacgccatgcaagatgagcaa
ggtcatttctatctactcgaggtaaataccgtacctggtatgaccgaaaagtcgttggtg
ccgatggcagcaaaagcaacgggtgtaagttttgaacaattagttgttcgcattttggag
caaacgctttaa

DBGET integrated database retrieval system