KEGG   Pseudoalteromonas piscicida: B1L02_14880Help
Entry
B1L02_14880       CDS       T04942                                 

Definition
(GenBank) peptidoglycan glycosyltransferase FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
ppis  Pseudoalteromonas piscicida
Pathway
ppis00550  Peptidoglycan biosynthesis
ppis01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ppis00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B1L02_14880
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    B1L02_14880
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ppis01011]
    B1L02_14880
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ppis03036]
    B1L02_14880
Enzymes [BR:ppis01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     B1L02_14880
Peptidoglycan biosynthesis and degradation proteins [BR:ppis01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   B1L02_14880
Chromosome and associated proteins [BR:ppis03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    B1L02_14880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ASD68171
UniProt: A0A3B6Y5W5
LinkDB All DBs
Position
1:complement(3208836..3210650)
Genome map
AA seq 604 aa AA seqDB search
MNKPKQKTQSIITWRFALVCGVMLTVFMTLVARAAFLQVIEPDKAIEENEKRTVRVEKLN
VQRGMIFDRNGKELAVSVPVVSVYADPLAIDKALAKKVLRKARKEGEDYKALEQNDAELK
IRKQAWYDDELRWKELADVLRLKPENVDERLRGDPSRRFVYLKRQVTAVVANYIRQMRLP
GVHLLDESKRFYPSGEVTAHMIGVTDIDGKGIEGVERMFDSALTGTAGKRTIRKDAQGRE
VQVLSEEQRVEPEDVYLSIDLRIQAIAYRALKSAVLSYKATSGSAMVVDVHTGEILALVN
SPSFNPNDLSTAAPYKRRNRAMTDLFEPGSTLKPLAVLAGLNYGAVKATDTIDTYPGWMN
LSGGLVKDTRNNGELSLREILKISSNMGVAKISQMLPKEYFINLYQEVGFGEPTGSNMIG
ESAGLFYPNRRWSNFEIATLSYGYAVSVSTAQMARLYAMFGAGGILRPLTIVKQDEIPEG
KRIFSEQDTYAVVEMMESVFERGGTAHNVKVDGYRAAGKTGTSEKAVAGGYGDEYVGYFA
GVAPVSDPRLAVVVMVNEPAGDVYYGGQTAGPAFAEIMSNALRILNVAPDKERVAYISGA
DNDA
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaccgaagcaaaaaactcaatctattatcacctggcgctttgctttagtttgc
ggtgtgatgctaaccgtatttatgacccttgtggcacgcgctgcatttttgcaagtaatt
gagcctgacaaggcaattgaagaaaatgaaaagcgcaccgtgcgggtagagaaactcaat
gtacaacgaggcatgatcttcgaccgcaatggcaaagagctggcggtgagtgtgccagta
gtgagtgtctatgctgatcccctagctattgataaggcgcttgccaaaaaagtgctgcgt
aaagcccgtaaagaaggtgaagattataaagcactggagcaaaacgacgctgagctgaaa
atacgaaaacaagcttggtatgatgatgagctcaggtggaaagagcttgcagatgtgctc
agactcaaaccagaaaatgtcgatgaacggcttcggggagacccaagccgtcgttttgtc
tatttgaagcgtcaagtgacggcggttgtcgccaactatattcgtcaaatgcgtctgccg
ggcgtgcacttgcttgacgagtccaaacgcttctatccaagtggtgaagtaacggcgcac
atgattggtgtaacggatatcgatggtaaaggtatcgaaggtgtcgagcgcatgtttgac
tctgcattaaccggaacggctggtaaacgcaccattcgtaaagatgcgcaaggtcgtgaa
gtgcaagtgctctcagaagagcagcgtgttgagcctgaagatgtttacttgagtatcgac
ttacggatccaagccattgcctatcgagcattgaaatcagcagtactgagctacaaagca
acgtcaggatcggcgatggttgttgatgttcacactggcgagattctagccttagtgaat
agcccaagctttaatcctaatgacctaagtactgcagcaccttataaacgtcgtaatcgc
gccatgactgacttatttgagcccggttcaacattaaagcctttagcggtattagcgggt
ttaaattatggtgcggttaaggcaacagacacgatagatacttatcctggttggatgaac
ttaagcggtggcttagtgaaagacacacgcaataatggtgagctgagcttaagagaaatc
cttaaaatttccagtaacatgggtgttgcgaagatctcgcaaatgctaccaaaagaatat
tttatcaatttataccaagaagtgggctttggtgagccaaccggctcaaatatgattggt
gaaagcgctggtctattttatccaaaccgccgttggtctaactttgaaatagcaacacta
tcctatggttatgcggtatcagtaagcacagcacagatggcaagactttacgctatgttt
ggagcgggaggcatcttgcgaccactcaccattgtgaagcaggatgaaatccctgaaggt
aagcgcatttttagcgaacaagatacgtacgcagtggtagaaatgatggaatcagtattt
gaacgtggtgggacagctcacaacgtaaaggttgatggataccgtgccgctggtaaaaca
gggacttcagaaaaagcggtcgcgggtggctatggtgatgagtatgttggttatttcgca
ggtgttgcaccggtaagcgaccctaggcttgccgttgtggtgatggtgaatgaacctgcg
ggagacgtttactatggaggtcaaaccgcaggacctgcttttgctgaaattatgtctaat
gcactgaggattttaaacgtagcacctgataaagagcgtgtggcttatatttctggagca
gataacgatgcgtga

DBGET integrated database retrieval system