KEGG   Pseudoalteromonas piscicida: B1L02_15435Help
Entry
B1L02_15435       CDS       T04942                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
ppis  Pseudoalteromonas piscicida
Pathway
ppis00730  Thiamine metabolism
ppis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppis00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    B1L02_15435
Enzymes [BR:ppis01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     B1L02_15435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO
Motif
Other DBs
NCBI-ProteinID: ASD68268
LinkDB All DBs
Position
1:complement(3362595..3363608)
Genome map
AA seq 337 aa AA seqDB search
MSTHARVAILGFGLTGRIAALMLAERYQISVFEQAKQGTETSAGSVAAAMLAPLAESVVC
DEALALQGMESMKLWPQLLSKLESPVFFQQQGSLIVAHGQDRGDLVSFQQRLKPLKDHNA
EAVNGARIAQLEPELSGSFHQGLYLPCEGQLDNQAFYQSSAATLSKQGVEVNYGVHCDEA
QKAQLSQAYDWVIDCRGLGAKAACNGLRGVRGEVARIYAPEVTLTRPVRLMHPRYPIYIA
PKPEHQFVIGATEIESQDNGEITVRSTLELLSAAYSVHRGFAEARVLSLLAGLRPAFKDN
HPKIEQQGNVISINGLYRHGYLLAPLIVKQALSKELL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgtctactcatgcacgtgttgctatcttgggttttggcttaacagggcgcatcgccgcg
ttgatgctcgctgagcgttatcaaatcagcgtatttgaacaagcaaagcaaggtactgag
acctcagcaggtagtgtcgcggcggccatgttagcgccgttggctgagtctgtggtatgc
gatgaagcattggcgctgcagggaatggagtccatgaaactctggccacaattactgtcg
aagctggaaagcccggtatttttccagcagcaaggctctcttattgtggcgcatggtcaa
gaccgtggggatttagtgagttttcagcagcgcttaaaaccgttaaaagatcacaatgca
gaagcggtgaatggtgctcggatcgcgcaattggagccggagcttagcggttcgttccac
caaggtctgtatttaccttgcgaaggccagcttgataaccaggcgttttatcaaagtagt
gcggcaacactttctaagcaaggtgtagaagttaactatggtgttcattgtgatgaagcg
caaaaggcgcagcttagccaagcgtatgactgggtgattgattgtcgcggtcttggtgcg
aaagctgcgtgtaatgggcttcgtggcgtacgcggcgaagtggccagaatttatgctcca
gaagtgaccttgactcgacctgtgcgcttgatgcacccaagatatcccatttacattgcg
ccaaaaccggagcatcagtttgttattggtgcgacggagattgaatcgcaagataatggt
gagataacggtacgttctacactcgaattactctctgcagcttattcagttcatcgtggg
tttgccgaagcgcgagtattatctttattagcagggcttagacctgcgtttaaagataat
caccccaaaattgaacaacaaggtaatgtgatcagtatcaatggtctatacagacacggt
tatctgctggcaccgcttatcgtgaaacaagcactatctaaggagttattatga

DBGET integrated database retrieval system