KEGG   Pseudoalteromonas piscicida: B1L02_21875Help
Entry
B1L02_21875       CDS       T04942                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
ppis  Pseudoalteromonas piscicida
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C LpxI_N
Motif
Other DBs
NCBI-ProteinID: ASD69524
LinkDB All DBs
Position
2:771823..772887
Genome map
AA seq 354 aa AA seqDB search
MTTMKSICMREGEIILNEIDIPKPKSGQVLVKSLACGICGSDLHITRHGDEVFDIYKKLG
VMSDVAGASTDIMLGHEFAAEVVSFGANTKGNIAIGTRVTCVPLLMSQGGVGIGVTPDVH
GAYSEYFIVDEALLLPIPETVSSAAAALTEPLAVGLHAVNRSEIKTEDIALVAGCGSIGL
AAIAALRIRGVKHIIASDPQENKRKVAQQFGATHTVDPIQIDEVTFAAKLAGENRVVIFE
CVGVHQLINSFIVRAPMRATLVITGIHTADTQVNFGYATVKEMDIKCSYYYKPEEFAESL
QNIADDKVDWQKMCTGKVGIDGVTEAIGTLLKPNDHIKVIIEPWRNGSLMQVGK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgactacaatgaaatccatttgcatgcgcgagggtgaaatcatccttaatgaaatagat
ataccaaaacccaaatcaggacaggtgctggtaaagagtctggcgtgtggtatttgtggc
tcagacttacatatcacacgtcatggagatgaagtatttgatatatataaaaagcttgga
gtcatgtccgatgttgcaggtgcaagtacagatataatgttaggtcatgaatttgcggct
gaagttgtatcttttggcgcgaatactaaaggcaatattgcaataggtacacgagtcaca
tgtgtgcctttactaatgagtcaaggaggagttgggataggtgttacccctgacgtacat
ggtgcttattctgagtattttatcgttgatgaagcattattgctgccgataccggaaaca
gtttcttcagctgcggctgcgcttacagaacctttagcggtagggctacacgcagtgaat
cgttcagagatcaaaactgaggacatcgcgttggttgctggttgtggctctattggtttg
gccgcaatcgccgcattaagaattcgaggggtaaagcatattattgcatctgatcctcaa
gagaataaaaggaaagtggcgcagcagtttggagccactcacaccgtggatccgattcag
atagatgaggtgacttttgccgcaaaacttgctggcgaaaatcgtgttgtgatctttgag
tgtgttggtgttcaccagttaataaatagctttattgtgcgtgcgccaatgagagcaact
cttgtaattacgggcattcacaccgcagacacgcaagtcaacttcggatatgcaacggta
aaggaaatggatattaaatgttcttattactataaacccgaagaatttgcagagtctttg
cagaatatcgcagatgataaagtggattggcaaaaaatgtgtaccggtaaagtcggtatt
gacggtgttactgaagcgattggcacattactgaagccaaatgatcacattaaagtgatc
attgaaccatggcgcaacggatcattaatgcaagttggaaaatag

DBGET integrated database retrieval system