KEGG   Pseudomonas plecoglossicida: RK21_01357Help
Entry
RK21_01357        CDS       T03646                                 

Definition
(GenBank) membrane protein
  KO
K02040  phosphate transport system substrate-binding protein
Organism
ppj  Pseudomonas plecoglossicida
Pathway
ppj02010  ABC transporters
ppj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RK21_01357
  09132 Signal transduction
   02020 Two-component system
    RK21_01357
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppj02000]
    RK21_01357
Transporters [BR:ppj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    RK21_01357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP_like_2 PBP_like OmpA SBP_bac_11 DUF2059 SBP_bac_6
Motif
Other DBs
NCBI-ProteinID: AJG12865
UniProt: A0A099N123
LinkDB All DBs
Position
complement(1462693..1464000)
Genome map
AA seq 435 aa AA seqDB search
MPRLLVLLLTLLPLATLAEPAHLRVQGSNTIGAALLPALVQGQLRAQQATAIEQYPGKLA
NETVITARDKHGQPLRIDIAAHGSSTGFVALGHGEADLAAASRPINDNEASQLQALGDLR
AAAAEQVIGLDGVAVIVHPDNPLPQLTTGQLAQIFAGQIQRWEQLGVAGGAIHLYARDDR
SGTFETFKALVLEPQQSELSPKAQRFESSDELAARVGADRQAIGFSSLAAVHGAKVLAVA
EGDAPAMLPERALVASEDYPLSRRLYFYLPANPKPQAKALADFTQSPAGQAIVAQQGFVS
QQIKAQPVPLQADMPPRYRTLALQAQRLSVNFRFQEGSASLDNKALRDVQRVADYLRQAG
KLQRKAVLVGFGDPKETPGRAALLSRLRAQAVRRELARDGVEVLEVTGMGDELPVAGNEL
EQGRLRNRRVEVWVY
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcctgcttgtcttgctgctcaccctgctgccgctggcgaccctggccgagccc
gctcacctgcgcgtgcaaggctccaacaccatcggcgcggccttgctgccagcgctggtg
caagggcaattgcgcgcacagcaagctaccgccatcgaacaatacccaggcaagctggcc
aacgagactgtcatcaccgctcgcgataagcatggccagcctttgcgcatcgacatcgcc
gcacacggttccagcaccggcttcgtcgccctgggccatggcgaggccgacctggccgcc
gcgtcgcggcctatcaacgacaacgaagcaagccaactgcaggctttgggcgacctgcgc
gccgctgccgccgaacaagtcatcggcctggatggcgtcgcggtcatcgttcaccccgac
aacccgctgccacagctcaccacggggcaactggcacagatctttgccgggcagatccag
cgctgggagcaattgggtgttgccggcggggccatccacctgtacgcccgtgacgaccgc
tccggtaccttcgagaccttcaaggccctggtgctggaaccccagcaaagcgagctttcg
cccaaggcccaacgcttcgagtccagcgacgagctggccgcgcgagtgggcgccgaccgc
caggccatcggcttcagcagcctggcggcggtgcatggggccaaggtgctggcggttgcc
gagggtgacgcgccggccatgctgccggagcgtgcactggtggccagcgaggactacccg
ctatcgcggcgcctgtacttctacctgccggccaaccccaagccccaggccaaggcgctg
gccgatttcactcagagtcccgcgggccaggcgatcgtcgcccagcagggtttcgtttcg
cagcagatcaaggcccaacctgtgccccttcaggcggacatgccgccgcgctatcgcacc
ctcgccctacaggcgcaacggttgagcgtgaatttccgcttccaggaaggcagcgccagc
ctcgacaacaaggccctgcgcgatgtccagcgcgttgccgactacctgcgccaagcgggc
aaattgcagcgcaaggcggtgctggtgggctttggcgaccccaaggagacacccggtcgc
gccgccctgctgtcccgcctaagggcccaggcggtgcgccgcgagctggcgcgcgatggc
gtggaggtgctggaggtgacggggatgggggatgaactgccagtggcagggaacgaactg
gagcaagggcgactgcgtaatcgccgggtggaagtgtgggtttattga

DBGET integrated database retrieval system