KEGG   Pseudomonas plecoglossicida: RK21_01483Help
Entry
RK21_01483        CDS       T03646                                 

Definition
(GenBank) glutamate synthase subunit alpha
  KO
K22082  methylamine---glutamate N-methyltransferase subunit B [EC:2.1.1.21]
Organism
ppj  Pseudomonas plecoglossicida
Pathway
ppj00680  Methane metabolism
ppj01100  Metabolic pathways
ppj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    RK21_01483
Enzymes [BR:ppj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.21  methylamine---glutamate N-methyltransferase
     RK21_01483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GXGXG VGPC1_C
Motif
Other DBs
NCBI-ProteinID: AJG12991
UniProt: A0A099N2A8
LinkDB All DBs
Position
1590864..1591538
Genome map
AA seq 224 aa AA seqDB search
MNTIDLSSTSVRVLNQSLHGEVQDHEWRVTHPDGKHNLAVGINAAVAVDIEGHAGYYCAG
MNQQASVTVHGNVGVGVAENMMSGTVRVKGSASQAAGATAHGGLLVIEGDAGARCGISMK
GVDIVVGGSIGHMSCFMGQAGRLVVCGDAGDALGDSLYEVRIYVKGSVQSLGSDCIEKEM
RAEHLQELQELLNKAGLDHKAADFKRYGSARQLYNFKVDNASAY
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgatcgacctttccagcacctcggtgcgtgtcctcaaccagtccctgcacggt
gaggtgcaggaccacgaatggcgggtgacccaccccgacggcaagcacaacctggccgtg
ggcatcaacgccgccgtggccgtggatatcgaaggccacgccggctactactgcgccggc
atgaaccagcaggccagcgtcaccgtgcatggcaacgtcggtgtcggcgtggccgagaac
atgatgtccggcacggtacgggtcaagggcagcgcctcccaggccgccggcgccacagcc
catggcgggctgctggtgatcgagggtgatgccggcgcgcgctgcggtatttccatgaag
ggcgtggatattgtcgtcggcggcagcatcggccacatgagctgcttcatgggccaggcc
gggcgtttggtggtgtgtggcgatgccggcgatgcgctgggcgattcgctgtacgaggtg
cgcatctacgtcaagggctcggtgcagtcactgggttcggactgcatcgagaaagagatg
cgcgccgagcatctgcaagagctgcaggaactgctgaacaaggccggcctggaccacaag
gctgccgatttcaaacgctacggctcggctcgccagctgtacaacttcaaagtcgacaac
gccagcgcgtactga

DBGET integrated database retrieval system