KEGG   Pseudomonas plecoglossicida: RK21_02189Help
Entry
RK21_02189        CDS       T03646                                 

Definition
(GenBank) cytochrome B6
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
ppj  Pseudomonas plecoglossicida
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RK21_02189
Enzymes [BR:ppj01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     RK21_02189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AJG13697
UniProt: A0A0B5KHQ5
LinkDB All DBs
Position
complement(2333845..2334807)
Genome map
AA seq 320 aa AA seqDB search
MPICLQVRIVASMLVVLPAWVLAQSIGGPLTPLPAVPELDPARVELGRKLFNDSRLSLDN
SQSCADCHRLDRGGVDGQARSLGADGKPLPVHTPSVFNASLNFLQFWDGRAQSFDGLVHL
ATGNTDEKEDGWAAVVQRIADDPAYQTRFAEAYGKPVTAIDVKDALVTYQRTLLTPDSRF
DRYLKGDTSSLSLEEKHGYQRFQEYGCIACHQGVNIGGNMLQKFGVFDDYFANRGNVTGA
DRGRYNVTGDPDDLHLFKVPSLRNVEVTAPYFHDGSAPTLEAAVDAMFHYQLGRAPSDDD
KALIIKFLQTLTGQWEGKPL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgccgatttgtctgcaggttcgcatcgttgcctcgatgcttgtcgttttaccggcatgg
gtgctggcccagagcatcggtgggccgctcacgccattgccggcggtgcctgagcttgac
cctgcccgggtggaactggggcgcaaactgttcaatgactcgcgattgtccctcgataac
agccagtcctgtgctgattgccatcgcctggatcgtggtggcgtggacgggcaggcgcgc
tcgcttggtgcagatggcaaacccttgccagttcacacccccagcgtcttcaacgccagc
ctgaacttcctgcagttctgggatgggcgcgcgcaatcgtttgacggcctggtgcacctg
gcaaccggtaatacggacgagaaggaagatggctgggctgccgtggttcaacgaattgct
gacgatccggcttaccagacgcggtttgccgaagcctatggcaagccggtgaccgccatc
gatgtcaaagacgccctggttacgtaccagcgcaccctgctgacacccgattcacgcttc
gatcgctatctgaaaggagataccagcagcctcagcctggaagagaagcatggctatcag
cgcttccaggagtacggttgtatagcctgccaccagggtgtgaatatcggcggcaacatg
ctgcagaagttcggcgtcttcgatgattatttcgccaaccgtggcaatgttaccggggca
gatcggggacgctacaacgtgacaggtgacccggacgacctccacctgttcaaagttcca
agcctgcgaaacgtggaggtgactgccccttactttcatgacggttcggcgcccaccttg
gaagcagccgtcgatgccatgtttcattatcagttgggacgtgcgccgagcgacgatgat
aaagcgctgatcatcaagtttctccagaccctcaccggccaatgggagggtaaaccgcta
tga

DBGET integrated database retrieval system