KEGG   Pseudomonas plecoglossicida: RK21_02647Help
Entry
RK21_02647        CDS       T03646                                 

Definition
(GenBank) phosphate ABC transporter permease
  KO
K02037  phosphate transport system permease protein
Organism
ppj  Pseudomonas plecoglossicida
Pathway
ppj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    RK21_02647
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppj02000]
    RK21_02647
Transporters [BR:ppj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    RK21_02647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AJG14155
UniProt: A0A099MXI1
LinkDB All DBs
Position
complement(2776069..2777034)
Genome map
AA seq 321 aa AA seqDB search
MNTPFAIPANPDSACQPPSAKDFLVDRTFRALARIGVVLVLALVFALVYEVGRKALPGIE
KHGFDVLFGSVWDVNQGKYGILPAIWGTLYSALIALLIAGFFGVSMAIFLTQDFLPARLA
AVFRTIVELLAAIPSVVYGLWGIYVVIPAIRPLTTWLNSELGWIPFFGTSLSGPGLLPAA
LVLAIMILPTIAAVSQDALTSVPMKTKQAAYGLGATHWEAILKVMVPSAATGIFGSLVLG
LGRALGETMALAMLVGNANNISLSLFAPANTLAALLALNFPEAGPNEIEVLMYAALVLMF
ITLAVNVLGSMIMLYAQRGNK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaacactccttttgccatcccggctaaccccgactccgcgtgccagccaccgtctgcg
aaagacttcctggttgatcgcaccttccgtgcgcttgcacgcatcggtgtggtgctggtg
ctggcgctggtcttcgcgctggtctacgaagtgggccgcaaggcactgccaggcatcgag
aagcacggttttgacgtgctgttcggcagtgtctgggacgtcaaccaaggcaagtacggt
attctgccagcgatctggggcacgctctacagcgccctgatcgccctgttgatcgccggt
ttcttcggcgtcagcatggccattttcctgacccaggacttcctcccggcccggctggcg
gcggtgtttcgcaccatcgtcgagctgcttgctgccatccccagcgtcgtctacggcctg
tgggggatctatgtggtcatcccggccattcgcccgctgaccacctggctgaacagcgag
ctgggctggattccctttttcggtacttccctgagcggcccagggctgctgcctgccgcg
ctggtgctggcgatcatgattctgccgaccatcgccgccgtttcgcaggacgccctgacc
agcgtgccgatgaagaccaagcaggccgcctacggcctgggcgccacccactgggaggcc
attctcaaggtaatggtgccatcggcagccaccggtatctttggttcgctggtgctcggc
ctgggccgtgcgctgggtgaaaccatggcgctggccatgctggtgggcaatgccaacaac
atttccctgtccttgttcgccccggccaacacgctggcggccttgctggccctgaacttc
ccggaggccggcccgaacgagatcgaggtgctgatgtacgccgcactggtactgatgttc
atcaccctggcggtgaacgtactcggctcgatgatcatgctctacgcccagcggggtaac
aaatga

DBGET integrated database retrieval system