KEGG   Pseudomonas plecoglossicida: RK21_03336Help
Entry
RK21_03336        CDS       T03646                                 

Definition
(GenBank) 23S rRNA m(2)G2445 methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
ppj  Pseudomonas plecoglossicida
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ppj03009]
    RK21_03336
Enzymes [BR:ppj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     RK21_03336
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     RK21_03336
Ribosome biogenesis [BR:ppj03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    RK21_03336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 Methyltransf_25 Methyltransf_24 Methyltransf_15 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AJG14844
UniProt: A0A0B5K8A0
LinkDB All DBs
Position
complement(3497809..3500001)
Genome map
AA seq 730 aa AA seqDB search
MSDRFELYLTCPKGLEGLLAEEARGLGLDDVREHTSAIRGAADMETAYRLCLWSRLANRV
LLVLKRFSMKNADDLYDGVHAVDWADHLAADGTLAVEFSGHGSGIDNTHFGALKVKDAIV
DKLRNREGLRPSVEKIDPDVRVHLRLDRGEAILSLDLSGHSLHQRGYRLQQGAAPLKENL
AAAVLIRAGWPRIAAEGGALADPMCGVGTFLVEAAMIAADIAPNLKRERWGFSAWLGHVP
ALWRKVHDEAQARAQAGLAKPPLWIRGYEADPRLIQPGRNNVERAGLGDWVKIYQGEVST
FEPRPDQNQKGLVISNPPYGERLGDEASLLYLYQNLGERLRQACMGWEAAVFTGAPQLGK
RMGIRSHKQYAFWNGALPCKLLLFKVQPDQFVTGERRETQPEGAETRQQAAPASEPARLS
EGAQMFANRLQKNLKQLGKWARREQVDCYRLYDADMPEYALAVDLYQDWVHVQEYAAPRS
VDPDKAQARLLDALAAIPQALGISPQRVVLKRRERQSGTRQYERQATEGRFQEVNEGGVK
LLVNLTDYLDTGLFLDHRPMRTRIQREAAGKRFLNLFCYTATATVHAAKGGARSTTSVDL
SKTYLDWARRNLALNGFSERNRLEQGDVMAWLEGNRDSYDLIFIDPPTFSNSKRMEGVFD
VQRDHVQLLDLAMARLAPGGVLYFSNNFRKFQLDEHLMARYAVEEITAQTLDPDFARNNR
IHRAWRLQLR
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccgtttcgaactttacctcacttgccctaaaggcctggaaggcctgcttgcc
gaagaggcgcggggcctcggcctggatgacgtgcgcgagcacacctcggccattcgcggc
gccgccgacatggaaaccgcctaccgcctgtgcctgtggtcacgtctggccaaccgggtg
ctgctggtactcaagcgcttctccatgaagaacgccgacgacctctacgacggcgtgcac
gcggtcgactgggccgatcacctggcagccgacggtaccctggcggtggagttcagcggc
catggctcgggcatcgacaacacccacttcggtgcgctgaaggtcaaggacgcgatcgtc
gacaagctgcgcaaccgcgaaggcctgcgcccgtcagtggaaaagatcgaccctgatgtg
cgcgtgcacctgcgtctggaccgtggcgaagccattctctcgctcgacctttccgggcac
agcctgcaccagcgtggctaccgcctgcagcaaggtgccgcgccgctgaaggaaaacctg
gcggcggcggtgctgatccgcgccggctggccgcgcattgccgccgaaggtggtgcgctg
gccgacccgatgtgcggtgtgggtaccttcctggtcgaagcggcgatgatcgccgccgat
atcgcgcccaacctcaagcgtgagcgctggggcttcagtgcctggctcggccacgtaccg
gcattgtggcgcaaggtgcatgacgaggcgcaggcgcgggcacaggccggcctggccaag
ccaccactgtggatccgtggctacgaggccgaccctcggttgatccagccaggccgcaac
aacgtcgagcgtgccggcctgggcgactgggtgaagatctaccagggcgaagtcagcacc
ttcgagccgcgcccggaccagaaccagaaaggcctggtcatcagcaacccgccttatggc
gagcgcctgggtgacgaagccagcctgctgtacctctaccagaacctcggcgagcgcctg
cgccaggcctgcatgggctgggaggcggcggtattcactggcgcgccgcagctgggcaag
cgcatgggcattcgcagccacaagcagtacgcgttctggaacggcgccttgccgtgcaag
ctgctgctgttcaaggtgcagcccgaccagttcgttaccggcgagcgccgcgaaacgcag
cctgaaggcgcggaaacccgccagcaggcagcaccggccagcgagccggcgcgcctgtcg
gaaggggcgcagatgttcgccaaccgcctgcagaaaaacctcaagcaactgggcaagtgg
gcccgccgcgagcaggtcgattgctaccgcctgtacgatgccgacatgcccgaatatgcc
ctggcggtcgacctgtaccaggattgggtgcacgtgcaggaatacgccgcgccacgttcg
gtcgacccggacaaggcccaggcacggctgctcgatgcgctggcagccatcccgcaggcc
ctgggcatttcgccgcagcgtgtggtgctcaagcgtcgcgagcggcagagcggcacgcgc
cagtacgagcgccaggcaaccgaaggccgcttccaggaagtgaacgaaggcggcgtaaag
ctgctggtcaacctcaccgactacctcgacacgggcctgttcctggaccatcgcccgatg
cgcacgcgcatccagcgcgaagcagccggcaagcgcttcctcaacctgttctgctacacc
gccacggccaccgtgcacgcggccaagggcggcgcgcgcagcaccaccagcgtcgacctg
tcgaaaacctacctggactgggcgcgacgcaacctggcgctcaatggcttctccgagcgc
aaccgcctggagcaaggcgatgtgatggcctggctggaaggcaaccgcgacagctatgac
ctgatcttcatcgacccgccgaccttctccaactccaagcgcatggaaggcgtgttcgat
gtgcagcgtgaccacgtgcaactgctggacctggccatggcccgcctggcgccgggtggc
gtgctgtatttctccaacaacttccgcaagttccagttggacgagcaccttatggcgcgt
tatgcggtggaggagatcacggcccagaccctggacccggacttcgcgcgcaataaccgt
atccatcgcgcctggcgtctgcagcttcgttga

DBGET integrated database retrieval system