KEGG   Pseudomonas plecoglossicida: RK21_04038Help
Entry
RK21_04038        CDS       T03646                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ppj  Pseudomonas plecoglossicida
Pathway
ppj00970  Aminoacyl-tRNA biosynthesis
ppj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    RK21_04038
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ppj03029]
    RK21_04038
Enzymes [BR:ppj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     RK21_04038
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     RK21_04038
Mitochondrial biogenesis [BR:ppj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    RK21_04038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AJG15546
UniProt: A0A0B5KIQ7
LinkDB All DBs
Position
4235476..4236927
Genome map
AA seq 483 aa AA seqDB search
MHQLTLAEIARGLADKSFSSEELTGALLARIKQLDPQINSFISVTEDLALGQARAADARR
AAGETGALLGAPIAHKDLFCTNGVRTSCGSKMLDNFKAPYDATVVAKLAEAGMVTLGKTN
MDEFAMGSANESSHYGAVKNPWNLEHVPGGSSGGSAAAVAARLLPATTGTDTGGSIRQPA
ALTNLTGLKPTYGRVSRWGMIAYASSLDQGGPLARTAEDCALLLQGMAGFDAKDSTSIEE
PVPDYSANLNASLQGLRIGLPKEYFGAGLDPRIADLVQASVKELEKLGAVVKEISLPNMQ
HAIPAYYVIAPAEASSNLSRFDGVRFGYRCENPKDLTDLYKRSRGEGFGVEVQRRIMVGT
YALSAGYYDAYYVKAQQIRRLIKNDFMAAFNDVDLILGPTTPNPAWKLGAKSSDPVAAYL
EDVYTITANLAGLPGLSMPAGFVDGLPVGVQLLAPYFQEGRLLNVAHRYQQVTDWHTRAP
NGF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaattgaccctggccgagatcgcccgcggactcgccgacaagtcgttttcctcc
gaagagctgaccggcgccctgctggcgcgcatcaagcagctcgacccgcagatcaacagc
ttcatcagcgtcaccgaagacctggccctgggccaggcgcgtgccgccgacgcccgtcgc
gccgctggcgaaaccggcgcgctgctgggtgcccccatcgcccacaaggacctgttctgc
accaacggcgtacgcaccagctgcggctcgaagatgctcgacaacttcaaggcgccgtat
gacgccaccgtggttgccaagctggccgaagccggcatggtcaccctgggcaagaccaac
atggacgaattcgccatgggttcggccaacgaatccagccactacggcgcggtgaagaac
ccatggaacctcgagcacgtcccgggcggctcgtcgggcggttcggccgcggcagtggct
gcacgcctgctgccagccaccaccggcaccgacaccggcggctccatccgccaaccggcg
gcactgaccaacctcaccggcctcaagccaacctacggccgcgtgtcgcgctggggcatg
atcgcctacgcctccagcctcgaccagggtggcccgctggcccgtaccgccgaagactgc
gccctgttgctgcaaggcatggccggtttcgacgccaaggactccaccagcatcgaagaa
ccggtgccggactacagcgccaacctgaatgcttcgctgcaaggcctgcgcatcggcctg
ccgaaggagtacttcggtgccggcctcgacccacgcatcgccgacctggtccaggccagc
gtcaaggagctggaaaagctcggcgcggtggtcaaggaaatcagcctgccgaacatgcag
cacgccatcccggcctactacgtgatcgcccccgctgaagcctcgtccaacctgtcgcgt
ttcgatggcgtgcgcttcggctaccgctgcgagaacccgaaagacctcaccgacctgtac
aagcgttcgcgtggcgaaggtttcggtgtcgaagtgcagcgccgcatcatggtcggcacc
tacgccctgtcggccggctactacgacgcctactacgtgaaggcgcagcagatccgccgc
ctgatcaagaacgacttcatggccgccttcaacgacgtcgacctgatcctcggcccgacc
acgccaaacccggcctggaagctcggcgccaagagcagcgacccggtcgccgcctacctg
gaagacgtctacaccatcaccgccaacctggcgggcctgccgggcctgtcgatgccggcc
ggcttcgtcgatggcctgccggtcggcgtgcagctgctggcgccatacttccaggaaggc
cgcctgctcaacgtcgcgcaccgctaccagcaagtgaccgactggcacacccgcgccccc
aacggcttctga

DBGET integrated database retrieval system