KEGG   Pseudomonas plecoglossicida: RK21_04953Help
Entry
RK21_04953        CDS       T03646                                 

Definition
(GenBank) 4-hydroxybenzoate octaprenyltransferase
  KO
K03179  4-hydroxybenzoate polyprenyltransferase [EC:2.5.1.39]
Organism
ppj  Pseudomonas plecoglossicida
Pathway
ppj00130  Ubiquinone and other terpenoid-quinone biosynthesis
ppj01100  Metabolic pathways
ppj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    RK21_04953
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ppj01006]
    RK21_04953
Enzymes [BR:ppj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.39  4-hydroxybenzoate polyprenyltransferase
     RK21_04953
Prenyltransferases [BR:ppj01006]
 Compound prenylation
  4HB prenyltransferase
   RK21_04953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiA Wzy_C
Motif
Other DBs
NCBI-ProteinID: AJG16461
UniProt: A0A099N7R1
LinkDB All DBs
Position
5190709..5191599
Genome map
AA seq 296 aa AA seqDB search
MYMQLLKSLNRLHPRAWDFVQLSRMDRPIGIYLLLWPTLSAVWIAGNGSPTLANVLIFGL
GVVLMRAAGCCINDFADRKVDGHVKRTADRPLASGRVRPREALALFAILVGVSFLLVLCT
NSRTVWLSFGAVALAFCYPFMKRYTYYPQVVLGAAYSWGIPMAFTAAGGELPASAWLLYI
ANLLWTVGYDTYYAMVDRDDDLKIGVKSTAILFGDADRTIILTLQLLSLGCLLLAGSRFE
LGGWFHLGLLGAAACFAWEYWSTRKLDRESCFKAFLHNHWAGMLVFIGVVLDYALR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgtacatgcaactgctgaagtcgctcaaccgcctgcacccgcgggcctgggactttgtc
cagctcagccgcatggaccggccaattggtatctacctgctgctgtggccgaccttgtcg
gcggtgtggattgctggcaacggttcaccaaccctggccaacgtgctgatctttggcctc
ggtgtggtgctgatgcgcgccgcaggttgctgcatcaacgactttgccgaccgcaaggtg
gacggccacgtcaaacgcaccgccgaccgccccctggccagcggccgggtccgcccgcgc
gaagcactggcgctgttcgccatcctggtcggagtgagcttcctgctggtgctgtgcacc
aacagccgcacggtgtggctgtcgttcggtgcggtagctctggcgttctgctacccgttc
atgaagcgctacacctattacccgcaggtggtgctgggggcggcgtattcctggggcatt
cccatggccttcaccgcagcgggtggcgagctgccggccagcgcctggctgctgtacatc
gccaacctgctgtggacggtgggctacgacacctactacgccatggtcgaccgtgatgac
gacctgaagattggcgtgaagtcgaccgccatcctgttcggcgatgccgaccgcaccatc
atcctcaccttgcagctgctgtcgctgggctgcctgttgctggccggcagccgcttcgag
ctgggtggctggttccacctggggctgctgggcgcggcggcgtgctttgcctgggagtac
tggtcgacgcgcaagctggaccgggagtcgtgcttcaaggcgtttctgcacaatcactgg
gcggggatgctggtgtttatcggggtagtattggattacgcactgcgttga

DBGET integrated database retrieval system