KEGG   Pseudomonas plecoglossicida: RK21_04982Help
Entry
RK21_04982        CDS       T03646                                 

Definition
(GenBank) acetyltransferase
Organism
ppj  Pseudomonas plecoglossicida
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_9 FR47 Acetyltransf_CG Acetyltransf_3 PanZ
Motif
Other DBs
NCBI-ProteinID: AJG16490
UniProt: A0A099N642
LinkDB All DBs
Position
5220212..5220658
Genome map
AA seq 148 aa AA seqDB search
MSSVTLRPVTTQDHAAWLALWQAYLHFYESELAEEVSLSTWQRLLDPNEPTHSALAWVDG
KAVGMVNFIYHRSNWSIGNACYLQDLYVDSGQRGLGIGRQLIEHVYAQAKTDNCIKVYWV
THETNATAISLYQQVAERSGFIQFRKEF
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgtcaccctgcgtcctgtcaccacccaagaccatgctgcctggcttgccctg
tggcaggcctacttgcacttctatgaatccgaattggccgaagaggtcagcctcagcacc
tggcaacgcctgctcgacccaaacgaaccgacccattcagccttggcctgggtcgatggc
aaggcggtgggcatggtcaacttcatctaccatcgttccaactggagcattggcaacgcc
tgctacctgcaggacctgtacgtggacagcgggcagcgcggcctgggcatcggccgccag
ctgatcgagcacgtctacgcccaagccaagaccgacaactgcatcaaggtgtactgggtg
acccatgagaccaacgccaccgccatcagcctgtaccaacaggttgccgagcgctcgggc
ttcatccaattccgcaaagagttctaa

DBGET integrated database retrieval system