KEGG   Pseudomonas plecoglossicida: RK21_04983Help
Entry
RK21_04983        CDS       T03646                                 

Definition
(GenBank) acetyltransferase
Organism
ppj  Pseudomonas plecoglossicida
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_3 Acetyltransf_1 Acetyltransf_4
Motif
Other DBs
NCBI-ProteinID: AJG16491
UniProt: A0A099N7T6
LinkDB All DBs
Position
5220667..5221338
Genome map
AA seq 223 aa AA seqDB search
MTDALNWKPAAVPQAEPIDGRFIRLEKLDPARHGDDLWEVLQGPAADPALWDYLPYGPFA
ERAAFDRWLEGNAAGRDPLFYTVIDRTSGQAQGILSLMSIVPDHGRIEIGHIAFGAAMQR
TPKGTEAVYLLGKLGFELGNRRLEWKCNNANARSKRAAERFGFVYEGVFRKHLVVKDHNR
DTAWYSITDDEWPAVAAGFERWLSDTNQQPGGQVETLEACRKG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcattgaactggaaacccgccgcagtcccacaggccgagcctatcgacggc
cgtttcatccgcctcgaaaagcttgacccggcgcgacatggcgacgacctctgggaggtg
ttgcaaggcccggctgccgatccggcactgtgggactacttgccctatggcccatttgcc
gagcgtgccgccttcgaccgttggctggaaggcaacgccgccggccgcgacccgctgttc
tacaccgtcatcgaccgcaccagcggccaggcccagggcatcctcagcctgatgtcgatc
gtgcccgaccacggtcgcatcgaaattggccacatcgccttcggcgccgccatgcagcgt
acacccaagggcaccgaggcagtgtacctgctgggcaagctgggcttcgagctgggcaac
cgccggctggagtggaagtgcaacaacgccaacgcccgctccaagcgcgcggcggagcgg
tttggctttgtctatgaaggagtgttccgcaagcacctggtggtgaaggaccacaatcgg
gatacggcgtggtattcgattaccgatgatgagtggccagcggtggctgctgggttcgag
cggtggttgagcgataccaaccaacaacctggaggtcaggtagaaacacttgaggcatgc
cgtaaaggttga

DBGET integrated database retrieval system