KEGG   Pseudomonas plecoglossicida: RK21_04985Help
Entry
RK21_04985        CDS       T03646                                 

Definition
(GenBank) pyruvate carboxylase subunit A
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
ppj  Pseudomonas plecoglossicida
Pathway
ppj00020  Citrate cycle (TCA cycle)
ppj00620  Pyruvate metabolism
ppj01100  Metabolic pathways
ppj01120  Microbial metabolism in diverse environments
ppj01200  Carbon metabolism
ppj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RK21_04985
   00620 Pyruvate metabolism
    RK21_04985
Enzymes [BR:ppj01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     RK21_04985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATP-grasp_4 DUF1611_N
Motif
Other DBs
NCBI-ProteinID: AJG16493
UniProt: A0A099N8P0
LinkDB All DBs
Position
complement(5223338..5224753)
Genome map
AA seq 471 aa AA seqDB search
MIKKILIANRGEIAVRIVRACAEMGIRSVAIYSDADRHALHVKRADEAHSIGAEPLAGYL
NPRKLVNLAVETGCDALHPGYGFLSENAELAEICAERGIKFIGPAAEVIRRMGDKTEARR
TMIAAGVPVTPGTEGNVADIHEALSEGDRIGYPVMLKATSGGGGRGIRRCNSREELEQNF
PRVISEATKAFGSAEVFLEKCIVNPKHIEAQILGDSFGNVVHLFERDCSIQRRNQKLIEI
APSPQLTPEQRAYIGDLAVRAAKAVNYENAGTVEFLLADGEVYFMEMNTRVQVEHTITEE
ITGIDIVREQIRIASGLPLSVKQEDIQHRGYALQFRINAEDPKNNFLPSFGKITRYYAPG
GPGVRTDTAIYTGYTIPPFYDSMCLKLVVWALTWEEAMDRGLRALDDMRVQGVKTTAAYY
QEILRNPEFRSGQFNTSFVESHPELTNYSIKRKPEELALAIAAAIAAHAGL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaaaaaatcctgatcgccaaccgaggtgaaattgcagttcggatcgtgcgtgcc
tgcgccgagatgggcattcgctcggtggcgatctattccgacgccgaccgccatgcgttg
cacgtcaagcgcgccgacgaagcccacagcattggtgccgagccgctggccggttacctg
aacccgcgcaagctggtgaacctggctgtggaaaccggctgtgatgccctgcacccaggt
tatggtttcctgtcggaaaatgctgaactggcagagatttgcgccgagcgcgggatcaag
ttcatcggccctgccgccgaggtcatccgccgcatgggcgacaagaccgaagcgcgtcgc
accatgatcgccgctggtgtgccggtaaccccgggtacagaaggcaacgttgccgatatt
cacgaagccctgagcgaaggtgaccgcatcggttacccggtcatgctcaaggccacctct
ggtggtggcggccgtggtattcgccgttgcaacagccgtgaagaactggaacagaacttc
ccccgcgtcatctccgaggctaccaaggcctttggttctgcggaagtgttcctggaaaag
tgcatcgtcaaccccaagcacatcgaggcgcagatcctcggtgacagctttggcaacgtc
gtgcacctgttcgagcgcgactgctcgatccagcgccgcaaccagaaactcatcgaaatc
gccccgagcccacagctcacccccgaacagcgcgcctacatcggcgacctggcggtgcgt
gcggccaaggcagtgaactacgagaacgccggtaccgtggagttcctgctcgccgatggc
gaggtgtacttcatggaaatgaacacccgggtgcaggtggaacacaccatcaccgaggaa
atcaccggtatcgacatcgtccgtgagcagatccgcattgcctcgggcctgccgctgtcg
gtcaagcaggaagacatccagcaccgcggttacgcgctgcagttccgcatcaacgccgaa
gatccgaagaacaacttcctgcccagcttcggcaagatcacccgttactacgcacccggc
ggcccgggcgtgcgtaccgacacggcgatctacaccggctacaccatcccgccgttctac
gactccatgtgcctgaaactggtggtgtgggcgttgacctgggaagaagccatggaccgc
ggcctgcgggccctggacgacatgcgcgtgcaaggggtgaagaccaccgccgcgtactac
caggaaatcctgcgcaatccggaattccgtagcggccagttcaacaccagcttcgtcgaa
agccacccggaactgaccaattactcgatcaagcgcaaacccgaagagctggccctggcc
atcgccgccgccatcgccgcccacgcaggcctgtga

DBGET integrated database retrieval system