KEGG   Pseudomonas plecoglossicida: RK21_04993Help
Entry
RK21_04993        CDS       T03646                                 

Definition
(GenBank) hypothetical protein
Organism
ppj  Pseudomonas plecoglossicida
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SUKH_5 SMI1_KNR4 SUKH_6
Motif
Other DBs
NCBI-ProteinID: AJG16501
UniProt: A0A099N654
LinkDB All DBs
Position
5232674..5233081
Genome map
AA seq 135 aa AA seqDB search
MEEVIEQLREANEPVPVPLELPDEDLLVEIEEELFINIPFVFKEFLLTVSDVVYGSLEPV
TVTDPQSHTYLPDVAANAWDAGVPRDLIPLCQDGDNYYCVEEDGTVVLWDAEEEIVGEDS
WESVWHWARDVWLES
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
gtggaagaagtgatcgaacaactccgtgaagccaacgagccagtgccggtgccccttgag
cttcccgacgaggacctgctggtcgaaatcgaagaagagctgttcatcaacattccgttc
gtgttcaaagagttcctgctgaccgtcagtgacgtggtgtatggctcactggagccggtg
accgttaccgacccacagtcacatacctacctgcccgacgtcgccgccaacgcctgggat
gccggcgtaccgcgtgacctgattccactgtgccaagacggcgacaactactactgcgtc
gaagaggatggcaccgtggtgctgtgggatgccgaagaggaaatcgtcggtgaagacagc
tgggaatcggtgtggcactgggcgcgggatgtctggctggagagctga

DBGET integrated database retrieval system