KEGG   Pseudomonas plecoglossicida: RK21_05007Help
Entry
RK21_05007        CDS       T03646                                 

Definition
(GenBank) tryptophan synthase subunit alpha
Organism
ppj  Pseudomonas plecoglossicida
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4917
Motif
Other DBs
NCBI-ProteinID: AJG16515
UniProt: A0A0B5KJC5
LinkDB All DBs
Position
complement(5246590..5247588)
Genome map
AA seq 332 aa AA seqDB search
MSYPVVQWAEIAQNYQRGTILLGNGASMAVSRSFGYGSLLEHAQHEGLLEGDVGRLFEFF
ETTDFELILRVVWQASNVNKSLAIADERTHQAYVRVRDCLIQAVRNVHPEHHEITEYLPH
MYEFLRGFDTVLSLNYDLLVYWTVMYGLGVQDGHLFKDCFINGEFDDDWGRFRKVFREKV
NTLVFYPHGSLALCRNNVEQEFKIHSAGAGLLESILQEWRSERFVPLFVSEGTMKQKIAS
IQNSYYLSTVYREVLTSPRQTLTLFGWGLGEHDRHLLKRMRGTGIQRVAVSVFRGDQPYC
NMAYQVIQDDLGPVEVEFFDSESPGCWIHSAE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtcataccccgtagtgcagtgggcagaaattgctcagaactatcaacgtggcaccatt
ctgcttggcaacggcgcgagcatggctgtgtcgcgaagctttggttatggctctctgctg
gagcacgcgcagcatgaggggctacttgagggagacgtggggcgcctgttcgaattcttc
gaaaccacggattttgagctgattttgcgggtggtctggcaagcgtccaacgtcaacaag
tcgttggcgattgcggatgagcgtacgcatcaggcatacgtgcgtgtccgagattgcctc
attcaggcggtgcgtaacgttcatcctgaacatcatgagatcactgaatatcttccccat
atgtacgagtttttaaggggcttcgataccgttttgtcgctgaactacgacttgctggtc
tactggacagtaatgtacggattgggggttcaagacgggcacctgtttaaggattgcttc
atcaacggagagtttgatgatgactggggacgcttccgaaaggttttccgagagaaggtc
aacaccctagtcttttacccacacgggagccttgcgttgtgtcgcaacaacgtggagcag
gagttcaaaatccactctgcgggagcaggtctgcttgagtccattctccaagagtggcgt
agtgagcggtttgtgccgcttttcgtcagcgaagggaccatgaaacagaagatcgcgtcg
atccaaaacagctactacctgtcgaccgtttaccgggaagtgctcacctcgccgcggcag
acactgacactgttcgggtgggggctaggggagcacgataggcacttgcttaagcgtatg
cgaggaactggcattcagcgcgtagccgtctcggttttccgaggggaccagccatactgc
aacatggcttaccaggttatccaggatgaccttggtcctgtcgaggtcgaattttttgac
agtgaaagtccgggatgctggattcattcagcggaatag

DBGET integrated database retrieval system