KEGG   Pseudomonas plecoglossicida: RK21_05021Help
Entry
RK21_05021        CDS       T03646                                 

Definition
(GenBank) RND transporter
  KO
K07003  uncharacterized protein
Organism
ppj  Pseudomonas plecoglossicida
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    RK21_05021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LolA_like MMPL DUF1329 Patched Sterol-sensing
Motif
Other DBs
NCBI-ProteinID: AJG16529
UniProt: A0A0B5KCZ5
LinkDB All DBs
Position
complement(5260392..5263523)
Genome map
AA seq 1043 aa AA seqDB search
MTWVVDHRRWVIAIVLALSAFFAFFAAKQQVIINPAAVVPQSHPYIKATNTIEKIFGSKY
LVVIGLTPTQGEALQPQVLEAVKRITDKLYAAPSVTKQTLLSLSSRQAKSIRGNADGFEA
KPLLSDQLPSSAAQIEELKAAINANPVYRDTVISSDWRTATIMLELKENPNGFGAMLSDV
RQILSQENTPGIEISLSGNPVFLHQAEVFADRINWLFPIAVLVIGLLHYEAFRTRQGLVL
PLVTALLSVVWGVGIMGLMKVPMDIFNSPTPILILAVAAGHAVQLLKRYYERFIELVNGQ
QMDPVVANRLATIQSLAAVGPVLVIAGGVAALGFFSLVVFELETVRAFGIFTGIGILAAV
LLEFTFTPAVRAGLKPPSAAQIDTETKPRIWDRLSARIAHLVVTPRSRHWILGGFVVLIG
VAVAGWPLVHVDNSSKSFFSDSLPLQRDDNLLNTQTGGTNVLYVMVDTGEADGVKDPRVL
DAIRYLQADAAKRPIVGKTLSIDDFLQRMHEAASGDTGAATPLPDDRELIAQYLFLYSMS
GDPEDFSAHVDYDYRRAKIAIMLRTNSNAEIDHLVNDLRQVASEHFPSNVTVSFGGEVAQ
TLAVTNVMVHSKLLNIAQILGVIFAVSVIAFRSVIAGLLVLSPLLVVLSLVFGVMGYFGV
PLNIPNSLISAMAVGIGADYAIYLIYRISEYTAQGKALPEAVEMAMKTAGKACLFVATAV
AGGYAVLMFSYDYKVHMWLSTFIVLAMLASVLATLTLIPSAILAFKPGFIFQRRSGDRGA
VLLIILAAIGFLTYSQVGWSAELGAKEIMERNAAVTRFSTSKADAEFVLQTQDGSQRIRK
SNMASKLQDNGQDTMRLVRFEAPADIRGTTTLLVERTAQDDEMWVYLPAMKRVRRLVASN
KKDSFIGTDFSYGDVMGHKVSDWKHTLVRQETRDGVEHYVIESLPAEDSVRTNSGYAKRM
TWIRKDNFATTYVEAADVSGAPYKQFSFTDIQLVDAANGKWQPMKTEGKNLQSGHTTSIT
FSNFKVGEALSDSLFSANNMASR
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtgggtggtggaccatcggcgatgggttatcgccatcgtgctggcgctgtcggcg
ttctttgcgttctttgccgccaagcagcaggtcatcatcaacccggctgccgtggtgccg
cagagccacccttacatcaaggcgaccaacactatcgagaagatctttggctcgaagtac
ctggtggtgatcggtctgaccccaacccagggcgaagccttgcagccccaggtgttggag
gcggtgaagcgcatcaccgacaagctctatgcggcgccgtcggtcactaagcagacgctg
ctcagcctgtcatcgcggcaggccaagagcatccgcggcaacgctgacggcttcgaggct
aaaccgctactgagtgaccagttgccgtccagcgcggcgcagatcgaggagctgaaggcg
gcgatcaacgctaacccggtgtaccgggacacggtgatctccagtgactggcgcaccgcg
acgatcatgctggagctcaaggaaaaccccaacggcttcggagcgatgttgtccgatgtt
cgtcagatcctgagccaggagaatacgccgggcatcgagatctccctgagtggcaacccg
gtgttcttgcatcaggctgaagtcttcgccgaccggatcaactggctgttcccgatcgcg
gtactggtcatcggcctgctgcactacgaagcgttccggactcgccaggggcttgttctg
ccgctggtgacggcgctgctgtcggtagtctggggcgtggggatcatggggttgatgaag
gtgccaatggacatcttcaactcgccgacgccgatcctgatccttgccgttgcggcaggg
cacgcggtgcagttgctcaagcgctactacgaacgcttcatcgagctggtgaacggtcag
cagatggaccctgtggtggccaaccggttggcgacgattcagtcgctggcggctgtgggc
ccagtgctggtgatcgctggcggtgtggcggccctcggtttcttttcgctggtggtgttc
gagctggaaaccgtacgggcattcggcatcttcaccggcatcggcatcttggcggccgtg
ctcctggagttcacctttaccccggcagtgcgggccggactgaagcccccatcggccgcg
cagatagataccgaaaccaagcctcgaatctgggatcgcctcagcgcccgaatcgctcat
ttggtggtgacaccgcgcagccggcactggattctcggcggttttgtggtgctgatcggc
gtggcggtcgccggctggccgctggtgcatgtggataattccagcaagagcttcttctcg
gactcgctgcccctgcaacgtgatgacaacctgctgaacacccagaccggcgggaccaac
gtgctctatgtgatggtcgataccggcgaagcggacggggtgaaggaccctcgcgtactg
gatgcgatccgctatctgcaggcggatgcggcgaagcgtccgatcgtgggcaagacactg
tctatcgatgatttcctccagcgtatgcacgaagcagcgtcgggtgacacgggggcagcc
acgccgcttcccgacgaccgcgagctgattgctcagtacctgttcctctactcgatgtca
ggtgatccggaggacttttcggcccacgtcgattacgactaccggcgggcaaagatcgcg
atcatgttgcgtaccaacagcaacgccgagatcgatcacctggtcaacgacctgcgccag
gtcgcgagcgagcatttccccagcaatgtcactgtgtcgttcggcggtgaggtcgcgcag
accctggcggtcaccaatgtgatggtgcacagcaagctgctcaacatcgcccagatcctc
ggcgtgatcttcgcggtgtcggtgatcgcgttccgctcggtgatcgccggcctgctggtg
ctgtcgccgctgctggtggttctgtcgctggtgtttggcgtcatgggctatttcggcgtg
ccgctgaacatccccaactcgctgatctctgccatggcggttggtatcggcgccgattac
gcgatctatctcatctaccgcatcagcgaatacacggcccagggcaaggcgttgcccgag
gcggtggaaatggcgatgaaaaccgccggcaaggcctgcctattcgtcgccaccgccgtg
gccgggggttatgccgtcctcatgttctcctacgactacaaggttcatatgtggctttct
acttttatcgtgctggcgatgctggcgagcgttcttgcaaccctgaccctgatccccagt
gccatcctggccttcaaacctggcttcatcttccagcgccgttccggtgaccgtggcgct
gtactgctgatcatcctggcggccatcggcttcctgacgtattcccaggtcggctggtct
gcggaactgggggcgaaagagatcatggagcgcaacgcggcggtaacccgcttcagcacc
tccaaggccgatgccgagtttgtgctgcagacccaggacggcagccagcggatccgtaag
tccaacatggcctcaaaacttcaggacaacgggcaggacaccatgcgcctggtgcgcttc
gaagcaccggcggatattcgcgggaccacgaccttgctagtcgagcggactgcccaggac
gacgagatgtgggtgtacttgccggcgatgaagcgtgtccgccgcctggtggcttcgaac
aagaaggacagtttcatcggaaccgacttcagctacggcgacgtgatggggcacaaggtc
agtgactggaagcacaccctggtcaggcaggagacccgtgatggcgtcgagcattacgtc
atcgagtcgctgcccgccgaggacagcgtgcgcaccaactccggctacgcgaagcgcatg
acctggatccgcaaggacaactttgcaaccacctatgtggaagcggccgacgtcagcggg
gcgccgtacaagcagttctccttcaccgatatccaactggtggatgccgccaacggcaag
tggcagccgatgaagaccgagggcaagaacctccagagcggtcacaccacttccatcacc
ttctccaactttaaggtgggtgaggcgctgagcgacagcctcttctcggcgaacaacatg
gcttcgcgctaa

DBGET integrated database retrieval system