KEGG   Pseudomonas plecoglossicida: RK21_05050Help
Entry
RK21_05050        CDS       T03646                                 

Definition
(GenBank) cation diffusion facilitator family transporter
Organism
ppj  Pseudomonas plecoglossicida
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cation_efflux
Motif
Other DBs
NCBI-ProteinID: AJG16558
UniProt: A0A0B5K7Q3
LinkDB All DBs
Position
complement(5292684..5293604)
Genome map
AA seq 306 aa AA seqDB search
MSTTATTHDHVFLGASHEENAKRTLWVVLLTVVMMVGEIAAGYITGSMALLADGFHMATH
AGALGIAAAAYAYAKRHATNSGFSFGTGKVGDLGGFASALILGLVALAVGAESIVRLFQP
NEVQFSIAIGIAIVGLLVNIVSALLLGHGHNHDHGHDHHHHHDHGHGHGDNNLQSAYVHV
LADALTSVLAIVALLAGKYLGWVWLDPVMGIVGAVVIGRWSWNLMKVTAGVLLDKTDDHV
AQEIREFIEQPGDVRICDLHVWRVGPDAHAAIVSVVGKAATSVESIRERLLPVHEIRHLT
VEIHQA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgacggcaaccacccatgaccatgtttttctcggtgcctcccatgaagagaat
gcgaagcgcacgctctgggtcgtgttgctgaccgttgtaatgatggtgggtgagattgcc
gcaggctacatcaccggatcgatggccctactcgccgacggcttccacatggccacacac
gctggtgcgctcggcatcgcggccgctgcatacgcgtatgccaagcgacacgccaccaac
tctgggttcagttttggtacgggcaaggtcggcgatctgggtgggtttgcttcggcgctg
atcctgggactcgttgccctggcagtgggtgctgagtcgatcgtccgtttgttccaaccg
aatgaagtgcaattcagcatcgcgattggtatcgcgatagttggcttgctggtgaacatc
gtgagtgcgttgctgctgggccacgggcacaaccatgatcacgggcatgaccaccaccat
caccacgatcatggccacgggcacggcgacaacaatctgcaatcggcctatgtgcatgtc
ctggccgatgcactgacctcggtccttgcgatcgtcgcactgctggcgggcaaatacctt
ggatgggtctggctcgaccctgtgatgggcatcgtcggcgccgttgttatcgggcgctgg
tcctggaacctgatgaaagtgactgccggcgtccttctggacaaaactgatgatcacgta
gcgcaggaaatccgcgagttcattgagcaaccgggtgacgtccgcatctgcgatcttcac
gtttggcgcgtaggccccgacgcccacgccgctatcgtcagcgttgttggcaaagccgca
accagtgttgaaagtattcgtgagcggctgttgccggttcatgaaattcggcacctgacc
gtcgaaattcaccaagcctaa

DBGET integrated database retrieval system