KEGG   Pseudomonas plecoglossicida: RK21_05051Help
Entry
RK21_05051        CDS       T03646                                 

Definition
(GenBank) hypothetical protein
Organism
ppj  Pseudomonas plecoglossicida
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trns_repr_metal YojJ
Motif
Other DBs
NCBI-ProteinID: AJG16559
UniProt: A0A0B5KD28
LinkDB All DBs
Position
complement(5293622..5293897)
Genome map
AA seq 91 aa AA seqDB search
MGHLASNKEALLKRVKRIAGQVQAIEKALQEEEDCAKTLLLVASARGAMNGLLDEIIKDH
ARAHVAHPSLTDEERSKGVEELLEAIQRYSK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgggccatctcgcatcgaacaaagaggcgctgctcaagcgcgtcaaacgcattgctggg
caggtgcaggcaattgaaaaagcccttcaggaagaagaggactgcgccaagaccctgcta
ctggtggcatcggcccgtggagcgatgaatgggttgctggacgaaatcatcaaggatcac
gccagggcgcacgtagctcacccgtcacttactgacgaagagcgcagcaagggcgtagaa
gaactcctggaagccattcagcggtactcaaaatga

DBGET integrated database retrieval system