KEGG   Pseudomonas plecoglossicida: RK21_05092Help
Entry
RK21_05092        CDS       T03646                                 

Definition
(GenBank) F0F1 ATP synthase subunit B
  KO
K02109  F-type H+-transporting ATPase subunit b
Organism
ppj  Pseudomonas plecoglossicida
Pathway
ppj00190  Oxidative phosphorylation
ppj01100  Metabolic pathways
Module
ppj_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:ppj00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    RK21_05092
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:ppj00194]
    RK21_05092
Photosynthesis proteins [BR:ppj00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   RK21_05092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-synt_B Apolipoprotein Mt_ATP-synt_B ESM4 V_ATPase_I HrpE HisKA MASE2 CdvA Spc7 TMPIT
Motif
Other DBs
NCBI-ProteinID: AJG16600
UniProt: A0A099N936
LinkDB All DBs
Position
complement(5335983..5336453)
Genome map
AA seq 156 aa AA seqDB search
MNINATLIGQSVAFLIFVLFCMKYVWPPVITALQERQKKIADGLDAANRAARDLELAQEK
AGQQLREAKAQAAEIIEQSKKRAAQLVEEARDQARVEADRVKAQALAEIEQELNSAKDAL
RAQVGALAVGGAEKILGATIDQNAHAELVNKLAAEI
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
gtgaacattaatgcaaccctgattggccaatccgttgcttttctgatttttgtactcttc
tgcatgaagtatgtgtggcctccggtcatcactgccctgcaagagcgccaaaagaagatt
gccgacggcttggacgctgccaaccgcgcagctcgcgacctggagctggcccaagagaaa
gcgggtcagcaactgcgtgaagctaaagcacaggcagccgaaatcatcgagcaaagcaag
aaacgcgctgctcagcttgtcgaggaagcccgtgatcaggcccgcgtcgaagctgaccgt
gtgaaggctcaggctctggccgagatcgaacaggaactgaacagcgctaaagacgccctg
cgcgcccaagtgggtgccctggccgttggtggtgctgaaaagatccttggcgccacaatc
gatcaaaacgcgcatgcggagctggttaacaaactggccgctgaaatttaa

DBGET integrated database retrieval system