KEGG   Pandoraea pnomenusa 3kgm: U875_01840Help
Entry
U875_01840        CDS       T02936                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ppk  Pandoraea pnomenusa 3kgm
Pathway
ppk00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ppk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    U875_01840
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ppk02000]
    U875_01840
Enzymes [BR:ppk01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     U875_01840
Transporters [BR:ppk02000]
 Other Transporters
  Pores ion channels [TC:1]
   U875_01840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N_2 GST_N GST_C_3 GST_N_3 GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AHB04278
UniProt: V5PLU0
LinkDB All DBs
Position
complement(401842..402447)
Genome map
AA seq 201 aa AA seqDB search
MKLYYSPGACSLSPHIVLREMGLTFELEKVDLQSKKTESGSDFRSVNPNGYVPLLVLDDG
QVLTEGPAIVQYLADRAPEARLAPEAGTMERYRLVEWLNFISTELHKAFAPLFNPKTPEE
WKTIVNDLIAARLAYVEKKLGGQVYLMGDNFTVADAYLFTVLSWGKWVGVDIGRWPTLQS
YTNRISSRPTVQAALKAEGLI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtactacagtcctggcgcttgttcgctttcaccgcacatcgtattgcgtgaa
atgggcttgacattcgagctcgaaaaagtggatctgcaaagcaaaaagaccgagagcggt
tctgactttcgcagcgtcaaccccaatggttatgtgccgctgctggttctcgacgatggg
caggtgcttacggaaggtccggcgatcgtacagtacttggccgatcgggctcccgaagcg
cggcttgcgcctgaagccgggacgatggagcgctatcgtttggtggaatggctaaacttt
atttcgaccgagcttcacaaggcttttgcaccgcttttcaatcctaaaacgccggaagaa
tggaaaaccatcgtaaatgatttgatcgcggcgcgtctggcttatgttgaaaaaaagctc
ggtggtcaggtctatctgatgggagataacttcacggttgctgatgcttatctgttcacc
gtgctgtcttggggcaagtgggtcggcgtagatatcggacgctggccgactttgcagagc
tatacgaatcgaatttcttctcgcccgaccgtgcaggccgcgctcaaagccgagggtctg
atctaa

DBGET integrated database retrieval system