KEGG   Pandoraea pnomenusa 3kgm: U875_01925Help
Entry
U875_01925        CDS       T02936                                 

Definition
(GenBank) phenol hydroxylase
  KO
K16246  phenol/toluene 2-monooxygenase (NADH) P5/A5 [EC:1.14.13.244 1.14.13.243]
Organism
ppk  Pandoraea pnomenusa 3kgm
Pathway
ppk00361  Chlorocyclohexane and chlorobenzene degradation
ppk00362  Benzoate degradation
ppk00623  Toluene degradation
ppk01100  Metabolic pathways
ppk01120  Microbial metabolism in diverse environments
ppk01220  Degradation of aromatic compounds
Module
ppk_M00548  Benzene degradation, benzene => catechol
Brite
KEGG Orthology (KO) [BR:ppk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    U875_01925
   00361 Chlorocyclohexane and chlorobenzene degradation
    U875_01925
   00623 Toluene degradation
    U875_01925
Enzymes [BR:ppk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.243  toluene 2-monooxygenase
     U875_01925
    1.14.13.244  phenol 2-monooxygenase (NADH)
     U875_01925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2 NAD_binding_1 FAD_binding_6 Fer2_4 FAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AHB04294
LinkDB All DBs
Position
complement(415434..416498)
Genome map
AA seq 354 aa AA seqDB search
MTYQLNIQPLGATIEVEEGQTILDAALRQGIYIPHACGHGLCGTCKVQVCDGEVDLGDAN
PFALMDFEREERKALACCATLLDDTTIEADIEEDPDAEVIPVEDFNAEVTRIEQLTPTIK
AVFLRLDQPIHFQAGQYVQLEIPELRQTRAFSIANSPADVAATGEIELNIRRVPGGQGTG
YIHEQLAVGNILHVTGPYGRFFVRRSADQPMVFMAGGSGLSSPRSMILDLLQSGWSKPIT
LIYGQRNEAELYYDEEFRELSQRYSNFSYVPALSEKAEGATHPLAQGFVHEVAKAHFENN
FSGHKAYLCGPPAMIDACVTTLIQGRLFERDIYFEKFISAADAQQVRSPLFKRV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgacctatcaactcaacattcagcccctgggcgccaccattgaggtggaggaagggcaa
actatactcgacgcggccttgcgccaaggcatttacattccgcacgcgtgtggtcacggg
ctatgtggaacctgcaaggtgcaggtgtgtgacggagaagtcgatctcggcgatgcgaat
cccttcgcgctgatggacttcgagcgcgaggagcgcaaggcgttggcctgctgcgccacc
ttgctcgatgacacgaccatcgaggccgacatcgaggaagacccggacgccgaagtcatc
ccggtcgaggatttcaatgccgaggtgacacgcatcgagcaactcacaccgacgatcaaa
gccgtcttcctgagactcgatcaaccgattcattttcaggcgggtcagtacgtgcaactt
gaaattcccgagttgcgccagacacgggcgttttccatcgccaattcacctgcggacgtc
gcagcaacgggagagatcgagctcaatattcgccgggttccgggaggacagggcacgggt
tacatccatgaacaactggcggtggggaacattctgcacgtgacgggtccctatggccgg
ttcttcgtgcgcaggtcagccgaccagcccatggttttcatggcaggtggttcaggcctg
tcgagccctcggtcgatgattctcgacttgttgcaaagcggatggagcaagcctatcacc
ctgatctatggccagcgcaatgaggcagaactgtattacgacgaggagttccgcgagctc
agccagcggtattcgaacttcagctacgtaccggcactatcggaaaaagcagaaggtgcg
acgcatcccttggcgcagggtttcgttcacgaggtcgccaaagctcatttcgagaacaac
ttttccggccacaaagcctatttgtgcgggccgccggcaatgatcgacgcctgcgtcacg
accctgatccagggccggttgttcgaacgcgacatctattttgagaagttcatttccgca
gccgatgcccaacaagtacgcagtccgcttttcaagagggtgtga

DBGET integrated database retrieval system