KEGG   Pandoraea pnomenusa 3kgm: U875_12990Help
Entry
U875_12990        CDS       T02936                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ppk  Pandoraea pnomenusa 3kgm
Pathway
ppk00061  Fatty acid biosynthesis
ppk00780  Biotin metabolism
ppk01100  Metabolic pathways
ppk01212  Fatty acid metabolism
Module
ppk_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ppk00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    U875_12990 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    U875_12990 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ppk01004]
    U875_12990 (fabZ)
Enzymes [BR:ppk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     U875_12990 (fabZ)
Lipid biosynthesis proteins [BR:ppk01004]
 Fatty acid synthase
  Component type
   U875_12990 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas PS-DH 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AHB06176
LinkDB All DBs
Position
complement(2834852..2835310)
Genome map
AA seq 152 aa AA seqDB search
MSETNINIDIHKIMKLLPHRYPMLMVDRVISLEPHANIKVIKNVTINEPYFTGHYPQRPV
MPGVLIVEALAQAAALLTFSEEAVHDENTLYYFVGIENVRFKRPVEPGDQLILDVDFLSE
RRGFFKFKGKALVDGKLAAEAEFMCMVKKNGE
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaccaacatcaatatcgacatccacaagatcatgaagctgctgccgcatcgc
tatccgatgctgatggtggaccgcgtgatcagcctggagccgcacgccaatatcaaggtc
atcaagaacgtcacgatcaatgagccgtatttcaccggccattatccgcagcgtccggtc
atgccgggcgtgctgatcgtggaagcgctggcgcaggccgccgcgctgctcacgttctca
gaagaagcggtgcacgacgaaaacacgctctactatttcgtggggatcgagaacgttcgc
ttcaagcgtcctgtcgaaccgggtgatcaattgatcctggacgtggacttccttagcgag
cgccgcggcttcttcaagttcaagggcaaggcgctggtcgacggcaagctcgcggcggaa
gccgagttcatgtgcatggtcaagaagaacggcgaataa

DBGET integrated database retrieval system