KEGG   Pandoraea pnomenusa 3kgm: U875_16965Help
Entry
U875_16965        CDS       T02936                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
ppk  Pandoraea pnomenusa 3kgm
Pathway
ppk00440  Phosphonate and phosphinate metabolism
ppk01100  Metabolic pathways
ppk01120  Microbial metabolism in diverse environments
ppk01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    U875_16965
Enzymes [BR:ppk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     U875_16965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL NTP_transferase IspD
Motif
Other DBs
NCBI-ProteinID: AHB06843
LinkDB All DBs
Position
3663204..3664913
Genome map
AA seq 569 aa AA seqDB search
MNAPDAFTLPPTATRAARLRAMLRSQQLEFLMEAHNGLSARIVREAGFKGIWASGLAISA
QFGVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNMRRLVRKLEQRGVAGVC
IEDKVFPKTNSFIGGERQPLADVDEFCGKIKAGKDSQGDDDFSIVARVEALIAGWGMEEA
LRRAEAYRLAGADAILIHSKLKRADEIVQFAREWDNRCPLVIVPTKYYSTPTDVFRDAGI
SVVIWANHLIRAATSAMQAVAAEIHRSETLVNVEDRIATVDEIFRLQDAEEYARAEDRYL
SAANAPRSAIVLAASRGKNLESVTTDRPKVMLPVAGKPLLRWLVDGFKKQGVNDITVVGG
YRADAIDTAGITLAVNERHAETGELASLAQVANAFAHDTVISYGDLLFRSYIVRDLVESE
ADFTVVVDSSAATTANAANASVRDFAYCSSGDDRGLFGQQARLEKISGDASDAGRTPNGR
WIGLLGVRGDDGRARLQRVFAALQTRPDFDRLGMPELINALAADGAAIAVQYVHGHWRGV
NDMEEFRRAGDFAHGQTPFSGAASEAQGD
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcccgacgcatttaccctcccgccgacggcaacgcgcgccgcgcgcctgcgc
gccatgctgcgcagccagcaactcgaatttctcatggaagcccacaacggcctgtccgcg
cgcattgtgcgcgaggcgggcttcaagggcatctgggcatccggtctggctatctcggcg
cagttcggcgtacgcgacaacaacgaagcgagctggacgcaagtcgtcgacaacctcgag
ttcatggccgacgcgagcgatctgccgatcctgctcgacggcgacaccggctacggcaac
ttcaacaacatgcggcgcctcgtgcgcaagctcgagcaacgcggcgttgccggcgtctgc
atcgaagacaaggtcttcccgaagaccaacagcttcatcggtggcgagcgccagccgctg
gccgacgtcgacgaattctgcggcaagatcaaggcaggcaaggactcgcagggcgacgac
gacttctcgatcgtcgcacgcgtcgaggctctgatcgcaggctggggcatggaagaagcc
ctgcgccgcgccgaggcgtaccgtctggccggcgccgacgccatcctgatccacagcaag
ctcaagcgtgccgacgagatcgtgcagttcgcccgcgaatgggataaccgctgcccgctg
gtgatcgtgccgaccaagtactacagcaccccgaccgacgttttccgggacgccggcatc
agcgtggtgatctgggcgaaccacctgatccgcgcggccacctccgccatgcaggcggtc
gccgcggagatccatcgcagcgaaacgctggtcaacgtcgaggaccgcatcgcgaccgtc
gacgagattttccgcctgcaggacgccgaggaatacgcccgggccgaagatcgttacctg
tcggccgcgaatgcgccgcgctcggccatcgtgctggcggcgagccgtggcaagaatctg
gaaagcgtgacgaccgatcgcccgaaggtgatgctgcctgtggccggcaagccgctgctg
cgctggctggtcgatggcttcaagaagcagggcgtgaacgacatcacggtcgtgggcggc
taccgtgccgacgccatcgacacggccggcatcacgctggccgtgaacgaacgccacgcc
gaaaccggcgaactggcctcgctcgcgcaggtggccaacgcgtttgcgcacgacaccgtg
atctcctacggcgacctgctgttccgcagctacatcgtgcgcgatctggtcgagagcgag
gctgactttaccgtcgtggtcgactcgagcgccgcgaccacggccaacgccgcgaacgcc
agcgtgcgcgacttcgcctattgctcgtcaggcgacgatcgcgggcttttcggccagcaa
gcgcggctcgagaagatcagcggcgacgcatccgacgccgggcgcacaccgaacggccgc
tggatcggcctgctgggcgtacgcggcgacgacggccgcgcgcgactccagcgtgtcttc
gcggcgttgcagacgcgcccggatttcgaccggctcggcatgccggagctcatcaacgcg
ctcgcggccgacggcgccgccatcgcggtgcaatacgtgcacggccactggcgaggggtg
aacgacatggaggaattccgccgcgcgggcgacttcgcccacggtcagacgcccttcagc
ggcgcagcgtcggaggcacaaggtgattga

DBGET integrated database retrieval system