KEGG   Pandoraea pnomenusa 3kgm: U875_18500Help
Entry
U875_18500        CDS       T02936                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppk  Pandoraea pnomenusa 3kgm
Brite
KEGG Orthology (KO) [BR:ppk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    U875_18500
Enzymes [BR:ppk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     U875_18500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 DAO FAD_binding_2 Thi4 Glutaredoxin FAD_oxidored HI0933_like K_oxygenase NAD_binding_8 FAD_binding_3 FMO-like NAD_binding_9 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AHB07119
LinkDB All DBs
Position
complement(4029324..4030916)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKAQLQTYLQKVTRPIEIAVWLDDSPKSAEMKALVDEIAPLSAQIRVAARDDAQE
RRPSFAIGTPGEAPRIRFAGLPMGHEFTSLVLALLQVGGHPVKLDDDTIAQIRALDGDFR
FETYISLSCQNCPEVVQALNVMALINPRIQQVTIDGALFQGEVEARQVMAVPTVFLNGES
FTQGRTSVKELLAKLDTGATARAAKALENKPVYDMVIVGGGPAGAAAAIYAARKGIATGV
VAERFGGQVLDTMAIENFVSVTHTEGPKFAVALEQHVKTYDVDVIDTQRAEALIPGKIHE
VRLASGAVLKARAVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVSEVTLIEYGAQLRADEVLQRKLRSLPNVRVLTNAQTTEIVGDRQKV
NALVYRDRVSGETSTIALEGVFVQIGLVPNTEWLKGTVALSRHGEIEVDAKGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFEHLMLSSVEDDAAQAPREAVAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcgaacctcaaagcccaattgcaaacgtaccttcagaaagtcacgcggccg
atcgagatcgccgtgtggctcgacgacagcccgaaatcggccgagatgaaggcgctggtc
gacgagatcgcaccgctcagcgcgcagatccgcgtggcggcgcgcgacgacgcgcaggag
cgtcgtccgtcgttcgccatcggcacgccgggcgaggcgccgcgtattcgcttcgccgga
ctgccgatggggcacgaattcacctcgctcgtgctggcgctgctgcaagtcggcggccac
ccggtgaagctcgacgatgacaccatcgcccagattcgcgcgctcgacggcgacttccgc
ttcgagacatatatctcgctgtcttgccagaactgcccggaagtcgtgcaggcgctcaat
gtcatggcgctcatcaatccgcgcatccagcaggtaacgatcgacggcgcgttgttccag
ggggaagtcgaggcgcgccaggtaatggccgtgccgacggtgtttctcaacggcgagtcg
ttcacgcagggccgcaccagcgtgaaggaattgctcgcgaagctcgacaccggcgcgacg
gcccgcgccgcgaaggcgcttgaaaacaagccggtctatgacatggtgatcgtcggcggt
ggcccggcaggcgcggccgctgcgatctacgcggcccgcaagggcatcgcgacgggcgtg
gtggcggagcgattcggcggtcaggtgctcgacaccatggccatcgagaacttcgtctcg
gtgacgcataccgaaggcccgaagttcgccgtggcgctcgagcagcacgtcaagacgtac
gacgtcgacgtcatcgacacgcaacgcgccgaagcgctgatcccggggaagatccacgag
gtgcgcctggccagcggcgcggtgctcaaggcgcgcgcggtggtgctggccaccggcgcg
cgctggcgggaaatcggcgtgccgggcgagcgcgaataccgcaatcgcggtgtggcgtac
tgcccgcattgcgacggtccgctcttcaagggcaagcgcgttgcggtcgtgggtggcggc
aattcgggtgtggaggcggccatcgatctcgcgggcatcgtcagcgaggtcacgctgatc
gagtatggcgcgcaactgcgtgcggacgaagtgctccagcgcaagctgcgcagtctgccc
aacgtgcgcgtgctcacgaacgcgcagacgaccgaaatcgtcggcgacaggcaaaaggtc
aacgcgctcgtgtaccgcgatcgcgtctcgggtgagacgtcgacgattgcgctcgaaggc
gtgttcgtgcagattggcctggtaccgaacaccgagtggctcaagggcaccgtggcgctg
tcgcgccatggcgaaatcgaggtcgatgcgaagggggcgacgtcggtgcccggcgtgttc
gcggcgggcgacgtgacgaccgtacctttcaagcagatcgtcatcgccgtgggcgagggc
gccaaggcatcgctcggcgccttcgaacacctgatgctcagctcggtggaggacgacgcc
gcacaggcgccgcgcgaggccgtcgccgcctga

DBGET integrated database retrieval system