KEGG   Postia placenta: POSPLDRAFT_55086Help
Entry
POSPLDRAFT_55086  CDS       T01162                                 

Definition
(GenBank) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ppl  Postia placenta
Pathway
ppl00052  Galactose metabolism
ppl00500  Starch and sucrose metabolism
ppl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    POSPLDRAFT_55086
   00500 Starch and sucrose metabolism
    POSPLDRAFT_55086
Enzymes [BR:ppl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     POSPLDRAFT_55086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-ProteinID: EED80090
JGI: 55086
UniProt: B8PG96
LinkDB All DBs
AA seq 893 aa AA seqDB search
MRQYAHIAAVVTTLASVWNARGQPYDVNICPGYTASNVVTSGPTLVANLTLAGAACNAYG
PDIEQLFLEVTYETESRIHVKISDPAHSRYEVPESVLPRPQADPSTSPETTAIRFNYTSS
PFTFTIYRASTSEVLFSTASYPLVYEPQYLRVKTSLPLNANIYGLGEHTEDFRLPTDDLV
RTLWSRDAYGVPNGTNLYGNHPIYFEHRVTGTHGVFLLSSNGMDIKINTTTEEGTTLEYN
VIGGVLDLYFLAGSETDPTEVARQYAEVVGTPAEVPYWAFGLHQCRFGYTDFVDIADVIQ
NYSLAGIPLETMWTDIDYMYNRRIFTLDPDYFPLTRMRQIIDYLHSHDQHYILMTDPAVA
YAPGEGYGTYDRGTAADVWLKAANGSFFLGAVWPGVTVFPDWFNPGVQDFWTNEFRLFYN
PVNGLDIDGAWIDMNEPSSFCTYPCTDPFQQAAEQDLPPPRTTIPPDPNAPIFVNSTDSN
VVLSLQKRQSDSGEDVLNPPYAIDNAAGALSNRTSYTNAVHANGLLDYDTHNLFGTMMST
VTHYAMLARRPGLRTLVVTRSTFAGAGAHVQKWLGDNMADWEHYRNSISGILSMASVFHV
PMVGADICGYAGDTTETLCARWAMLGAFYPFMRDHNDDTSISQEFYRWPTVAQAAKNALD
MRYRLMDYIYTAFHQASVDGTPVLNPLWYKYPQDQSTFAIDLQFFFGPSILVSPVTEENA
TSVSVYFPNDIFYDFATLAPVQGSGGFVEMTDVNLTSIPIHIRGGAILPLRSQGAMTTTA
LRQQPFELVIAPNATGEATGSLYMDDGVSITPASTTQVEMTYRAGVLTVTGSFGYPVGVN
LSRVLLLNADEATESVQLNGQEVATIPTYDSTTKVLSVTIDRLLDEGFSLRLQ
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgcgacagtatgcgcacatagcggctgttgtcacgacgctggcctccgtctggaatgcc
cgagggcaaccatacgatgtcaatatatgtcctgggtatactgcatcgaatgtcgtgact
agcggccccactctggtagcgaacctgacactggcgggcgcagcgtgcaacgcgtacgga
ccagatatcgaacaactgttcttggaagtgacttatgagaccgagagtcgcatccacgtg
aagatctccgacccagcccactcgaggtatgaagtcccagagtctgtcttgccccgccca
caggccgatccgtccacctctcccgagaccacggccatccgtttcaactatactagctcg
ccctttacattcaccatctaccgcgcgtccacctctgaggtgctcttctccaccgcatcc
tacccgctcgtctacgagccacagtatctgcgggtaaagacgagtctcccgctgaacgcg
aacatctacggcctcggcgagcacacggaggacttccgcctgcccacagacgacctggtc
cgcactctgtggtcgcgcgacgcgtacggggtgccgaacgggacgaatctgtacgggaac
cacccgatctacttcgagcaccgcgtgacgggcacgcacggcgtgttcctgctgagctcg
aacgggatggacattaagatcaacacgactacggaggagggcactacgctggagtacaac
gtcatcgggggcgtgctcgatttgtatttcctggcaggcagcgagacggacccgacggag
gtcgcacggcagtacgccgaggtggttggcacgccggcggaggtaccatactgggcgttc
gggctgcaccaatgccgcttcggatacactgactttgtcgacattgcggatgtgatccaa
aattattccttggccggcataccgttggagaccatgtggacggacatcgattacatgtac
aaccggcgtatatttacactcgacccagactatttccccttgacccgtatgcgtcagata
attgactacttgcactcgcacgaccaacactacattttgatgacggatcccgctgttgcc
tacgcgcccggggagggctacggcacgtacgaccgcgggacagcagccgacgtctggctg
aaggctgcaaacgggagtttcttcctgggcgcggtctggccaggcgttacagtattccca
gactggttcaaccccggcgtacaggacttctggacaaacgaattccggctattctacaac
ccagttaacggactcgacattgacggtgcatggatagacatgaacgagccatccagtttc
tgcacctacccgtgtacggatccattccagcaagctgcagaacaagatcttccaccgccg
cggacgacgatcccacctgacccgaacgcgcccattttcgtgaactcaaccgattctaat
gtcgttttgtcgctgcagaagagacaaagcgatagcggcgaggacgttctaaaccctcct
tacgccattgacaatgctgccggagcgttgtcaaataggacttcatatacgaatgcagta
cacgcgaacggcctgctcgactatgacacccacaacctgttcgggacgatgatgtccact
gtgacgcattacgccatgctagctcgccgaccaggcctccggacgctcgtggtcactcgc
tcgacgttcgccggtgcaggcgcacacgtgcagaagtggctcggcgacaacatggctgac
tgggaacactaccgaaactcgatatcgggaatcttgagcatggcgagcgtgttccacgtg
ccgatggtgggcgcagatatctgcggatacgccggggacactacggagacgctatgtgca
agatgggctatgctcggagctttctatccattcatgcgcgatcacaacgatgatacgtca
atcagccaagaattctaccggtggcctaccgttgctcaggcggcgaagaatgctttggac
atgagatatcgcttgatggattacatttataccgcatttcaccaggccagcgtggacggc
actcctgtcctgaatccgctttggtacaagtatccgcaggaccagtcgacgtttgcgatc
gacttgcaatttttcttcggcccgtcgatcttggtctcgcctgtcacggaggaaaacgca
acgtccgtcagcgtctacttcccgaacgacatcttctatgacttcgccactctcgcgcct
gtccagggcagtggagggtttgtcgagatgaccgacgtgaacttgacgtcgatcccgatc
cacatccgaggcggcgcaatcctgcctctccgctcgcaaggcgccatgactaccaccgcg
cttcggcaacaacctttcgagctggtcatcgcgccaaacgcgacgggcgaggcgacaggc
tcactgtacatggacgatggcgtctcgattacgccagcatcgacgacacaagtggagatg
acctacagagctggggtgctgacggtgacgggctccttcggctatccagtgggcgtgaac
ttgtcgagagtgctgcttctcaacgccgacgaggccacggagtctgtgcagctcaacggc
caggaggtggcgacgattccgacctacgactcaaccaccaaggtcctaagcgtcacgatc
gatcgtcttctcgatgaaggattctcgctacgtttacagtga

DBGET integrated database retrieval system