KEGG   Postia placenta: POSPLDRAFT_96457Help
Entry
POSPLDRAFT_96457  CDS       T01162                                 

Definition
(GenBank) predicted protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
ppl  Postia placenta
Pathway
ppl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    POSPLDRAFT_96457
Enzymes [BR:ppl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     POSPLDRAFT_96457
DNA repair and recombination proteins [BR:ppl03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     POSPLDRAFT_96457
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C BRCT_2 RNA_ligase BRCT DUF4073 SDA1
Motif
Other DBs
NCBI-ProteinID: EED85575
JGI: 96457
UniProt: B8P0P1
LinkDB All DBs
AA seq 980 aa AA seqDB search
MLPTPAPTSPPSSPRPEVTAAAEDHPIVYPPPPPTRGSAPFQVLAALFDKLQGERRPEKR
RRLLDSWFNKDRERAVYGLKEKNLAKIYIKLIPLNPRDPDAIRMLNWKRPTERNQSSGDF
PSVLYEVISKRSSVVEGTLTIHELNDHLDEISKNMGHSTTSEEQRWIARIILKDMQISVK
ETTVFAVFHPDAHALFNTCSDIKKIAWELWDPKRKLNDEVHLSPLRRIEDTVKEMQGSNF
IIEEKLDGERVQLHKRGNEYFYCSSSWATNRKGKDYTYLYGKHVGEGSLTPWIHKAFDAR
VDEIILDGEMLVWDPVSERNLPFGTLKTAALDRSKKERAPRPCFKIFDLLYLNGTPLLNK
SLKFRKRNLRACLKEVPGRMEFAVEYEGRTADDVRTRMEDIMASRGEGLVIKHPNSQYVL
SGRNSDWIKASCWTRGFNVKPEYMDSMGETVDVIVVAGNYGTGRRSGGVSTLVCAVVDDR
RPADEVEPKYSTFVRIGTGLSYADYIWVRQKPWKTWDPKNPPSFIQVAKKGSEDKGDVYL
EPQDSFLLKIKAAEITNSDLYHMGVTMRFPRAIQIREDLDTSDCTTATAVFESLRSDRKR
KMSDTDELSDCVNPKKKQRRTTKKPVILLPQYQSLKLEDVEVESDLFEGMTFMVSSDPKS
RTGEQDKKELLRMIRANGGKYVQMAKNNPDVLVVYGGTITPYDIKLIMNRDVCDIIKPQW
IRESVTKSERMPLTKRYFFHATSRRMEEDEYVQDDGSLEELALTDQHEEPLETNDKGDAT
QEDPSIADWFKVEKSSNRSEIQHDDTDSETEPDSDNDDVNRDEDIADEDDISDWVNVDNE
DSLKTEEDPVQDASESEPQVRMGETEEAREYDQELIFRHLCFYLDSPANAKKNSMSVKSK
NQDELNKGFEKLTTLITEHGGRVVDLDEPKLTHVVVDKRDLSLSSSRLAWTKKHCLMKMA
SAWQLALFLVLTPAPTEFAP
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctacgcctgcgccaacctcgccgccctcgtcaccacgtcctgaagtaacggcg
gcggcggaggatcacccaattgtctatcctccacctcctccgactagagggagcgcgcct
ttccaggtgctggctgctctcttcgataagcttcaaggcgagcgcagaccggagaagcgg
aggaggcttttagactcatggttcaacaaggaccgcgaacgtgcggtctatggtttgaag
gagaagaacctagcaaagatttatatcaaacttattcctcttaacccgagggatccggat
gcaattcgtatgcttaattggaagcgccctacagaaagaaatcaatcctcaggagacttc
ccttctgtattatatgaagtcattagcaagagatcatctgtggtggaagggacgttgacc
atccatgaactgaacgatcatctcgacgagatctcgaagaacatggggcactctaccaca
tctgaagaacagcgatggatagcacgcatcattttgaaagacatgcagatatcagtcaag
gagacgactgtcttcgccgtctttcatccagacgcgcatgctcttttcaatacatgttcc
gatatcaagaagattgcttgggaattatgggacccaaaacgtaaacttaacgatgaggtg
cacctatcgccgctccgacggattgaagatacagtaaaggaaatgcaaggtagcaacttt
atcatagaggagaagctcgatggcgagcgcgtgcaactgcataagcgcggaaacgagtac
ttctattgttctagctcatgggctacaaataggaaaggcaaagactacacttacctctac
ggaaaacatgtgggagaaggcagcttaacgccatggattcacaaggcattcgatgctcga
gtcgatgagatcattctcgatggcgaaatgctggtctgggatcctgtctctgagcggaat
cttccattcggtacattgaagaccgctgctcttgaccgatcgaagaaagagcgtgctcct
cgcccctgcttcaagatattcgatctcttgtacctgaacggcacgccccttctcaacaag
tcgctcaaattccgcaagcgcaatttacgggcctgtctgaaggaagtccctgggcgtatg
gagtttgcagttgaatacgagggccgcactgcggacgacgtgcgcactcgcatggaagat
atcatggcctctcgcggcgaaggtcttgttatcaagcaccccaactcgcagtacgtcctg
agtggtcgtaacagcgattggattaaggcaagttgttggactcgtggatttaacgtgaag
cctgagtacatggacagcatgggagaaacggtggatgtcatagtcgtcgccggaaactac
ggtactggccgacgttctggaggtgtctcgacactcgtatgcgctgtcgtcgacgatcgc
agacctgctgacgaggtagaaccaaagtatagcacctttgtgcgcataggaaccggtctt
tcatacgcggactacatatgggtacgacagaagccctggaagacttgggatccgaaaaac
cctcctagttttatacaagtcgcaaagaaagggtctgaggacaagggcgatgtgtatcta
gagccccaagattcctttctgctcaagattaaggctgccgaaatcactaactcagatcta
tatcatatgggcgtgacgatgcgctttccgcgtgcgattcagatccgggaggacctcgac
acttccgattgtacgactgcgaccgccgtttttgaaagtctgcggtcggataggaagagg
aaaatgagtgatactgatgagttgagtgattgtgtgaacccgaaaaagaagcagaggaga
accacgaagaagccggtaattcttctccctcagtaccagagcttaaagctagaggacgtc
gaggttgagagtgatcttttcgaggggatgaccttcatggtttcatccgatccaaaatcg
agaacgggcgaacaagataagaaagagctcctgcgaatgatccgtgccaatggaggcaag
tacgtccaaatggcaaagaacaaccctgatgtgcttgttgtatatggaggcacaatcact
ccttacgacattaagctcatcatgaacagggatgtctgcgacattatcaagccgcaatgg
atcagggaatctgtaacgaagagtgaacgaatgccgctgaccaagaggtacttcttccat
gccacttctcgtcgcatggaagaggacgaatacgttcaggatgatggaagcctcgaagag
ctggctctcacggatcagcatgaagagccccttgagaccaatgacaagggggatgcaact
caagaggatccctctatagcggattggttcaaagtcgagaagtcatcgaatagatctgag
atacagcacgacgatacggacagcgagacggaacctgattctgataatgatgatgtgaac
cgggatgaggacatagcagacgaggatgatatcagtgattgggtcaacgtggacaacgaa
gactcattgaaaaccgaagaagacccggtgcaggatgctagcgagtctgaacctcaagtc
cgcatgggggagaccgaggaggcccgggaatacgaccaggagctaatcttccgacatcta
tgcttctaccttgattcccctgcgaatgctaagaagaatagtatgtctgttaaaagcaag
aatcaagatgagctcaacaagggtttcgagaaattgacgacactgatcactgagcatggg
ggccgcgtcgtggaccttgatgaacccaagctcacgcatgtcgttgttgataagcgagac
ttgtcgctgagttcatccaggcttgcttggacgaagaaacattgcttgatgaagatggca
agtgcctggcaactcgctttgttccttgtgttaacgcctgctcccacagaattcgcgcca
tga

DBGET integrated database retrieval system