KEGG   Planococcus plakortidis: BBI15_00395Help
Entry
BBI15_00395       CDS       T04812                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ppla  Planococcus plakortidis
Pathway
ppla00970  Aminoacyl-tRNA biosynthesis
ppla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppla00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BBI15_00395
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ppla03029]
    BBI15_00395
Enzymes [BR:ppla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BBI15_00395
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BBI15_00395
Mitochondrial biogenesis [BR:ppla03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BBI15_00395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N
Motif
Other DBs
NCBI-ProteinID: ANU18813
UniProt: A0A1C7E4B1
LinkDB All DBs
Position
980816..982246
Genome map
AA seq 476 aa AA seqDB search
MNFETIIGLEVHVELKTESKMFSPSPAHFGAEPNTNTNVIDLGYPGVLPVVNKTAVDWAM
KAALALNCEISRHTKFDRKNYFYPDNPKAYQISQFDEPIGEHGWLEIEVNGEKKRIGITR
LHMEEDAGKLTHTGNGHSLVDFNRQGTPLIEIVSEPDIRTPEEAYAYLEKIKSIIQYTGV
SDVRMEEGSLRCDANISLRPYGRDEFGTKTELKNLNSFNFVKKGLEHEQIRQEQVLLAGG
IIEQETRRYDESTGKTVLMRIKEGSDDYRYFPEPDLVDIVIDDAWLERVRAEIPELPDAR
KARYVSELGLSSYDAMVLTLQKPISDFFEATVKAGADAKLTSNWMMGEVSAYLNAQNKEL
EDTQLTPQGLAGMIKLIGEGTISSKIAKKVFKELIEKGGDANKIVKAQGLVQISDEKVLL
EYVSNTLDANPQSIEDYKNGKDRAIGFLVGQIMKATKGQANPPLLNKILLEEIAKR
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcgaaacgatcatcgggcttgaagtccacgtcgaactgaagacggaatccaaa
atgttctcgccttccccggctcatttcggtgcggagccgaataccaatacaaacgtaatc
gaccttggctaccctggggtattgccggtcgttaataaaacggcggtcgattgggcgatg
aaagcagcacttgcgttgaactgcgaaatttcacgccataccaaattcgaccgcaaaaac
tatttctacccggataacccgaaagcataccagatttcgcaattcgatgagccgatcggc
gaacacggctggctggaaattgaagtgaacggcgagaaaaaacgcatcggcatcacgcgc
ctccatatggaagaagatgccggaaaactgacgcatacaggcaatggccattcccttgtc
gactttaaccgccaaggcacgcctttgatcgaaatcgtctcggagccggatatccgcacg
ccggaagaagcgtatgcgtatttagaaaaaatcaaatcgatcatccaatacacaggcgtt
tccgatgtgcgcatggaagaaggctcgcttcgttgcgacgccaatatctccttgcgccca
tacggccgcgatgaattcggcacgaaaactgagctgaagaacttgaactcgttcaacttc
gtcaaaaaaggcttggagcacgaacaaattcgccaagagcaagtattgcttgcaggcggc
atcatcgagcaggaaacacgccgctacgatgaatcgactggcaaaactgtgctcatgcgc
atcaaggaaggttcggacgattaccgttatttcccggaaccggacctagtcgatatcgtc
atcgacgatgcatggctcgagcgcgtgcgcgcagaaattccagaacttccggatgcccgt
aaagcccgttacgtatcagaacttggcttgtcgtcttacgatgccatggtgctgactttg
cagaagccgatttcggatttcttcgaagcaactgtcaaagccggagccgatgcgaaactc
acgtcgaactggatgatgggcgaagtgtccgcttacctcaatgcccagaataaggagctt
gaggatacgcaactgacgccgcaaggacttgccggcatgatcaaattgatcggcgaaggc
acgatctcctcgaagatcgccaagaaagtcttcaaggaattgatcgaaaaaggcggcgac
gcgaacaagattgtcaaagcgcaaggcttggtacagatctcggacgaaaaggtattgctt
gaatacgtcagcaataccttggatgccaacccgcaatcgatcgaagattacaagaacggg
aaagaccgcgcaatcggcttcctcgtcgggcaaatcatgaaagcgacaaaagggcaggcc
aatccgccgctcttgaacaaaatcctcctcgaggaaatcgcgaaacgttaa

DBGET integrated database retrieval system