KEGG   Planococcus plakortidis: BBI15_03395Help
Entry
BBI15_03395       CDS       T04812                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
ppla  Planococcus plakortidis
Pathway
ppla00061  Fatty acid biosynthesis
ppla00620  Pyruvate metabolism
ppla00640  Propanoate metabolism
ppla01100  Metabolic pathways
ppla01110  Biosynthesis of secondary metabolites
ppla01120  Microbial metabolism in diverse environments
ppla01130  Biosynthesis of antibiotics
ppla01200  Carbon metabolism
ppla01212  Fatty acid metabolism
Module
ppla_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ppla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBI15_03395
   00640 Propanoate metabolism
    BBI15_03395
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BBI15_03395
Enzymes [BR:ppla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BBI15_03395
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BBI15_03395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_3 ATP-grasp_5 GARS_A ATPgrasp_Ter CzcE ATP-grasp_4 Ntox43
Motif
Other DBs
NCBI-ProteinID: ANU19320
UniProt: A0A1C7E652
LinkDB All DBs
Position
1564937..1566289
Genome map
AA seq 450 aa AA seqDB search
MMKKVLIANRGEIAVRIIRACKELDIQTVAVYSEADKEALHVELADEAYCIGPKLSKDSY
LNFSNIISVAKLTNCDGIHPGYGFLAENSSFAELCEACDIMFIGPTAAAISKMGTKDVAR
ETMRAAGVPVVPGSTGIVGSEEEGLEIAEKIGFPVIIKATAGGGGKGIRVARTREDFIKG
LNMTQKEAAAAFGNPGVYIEKFIEDFRHIEIQVLADSHGNAIHLGERDCSIQRRMQKLVE
EAPSPALSEELRAEMGEAAVKAAQAVNYRGAGTVEFIFDVENQKFYFMEMNTRIQVEHPV
TEMITGIDLIQQQLKVASGETLAYKQEDVTFKGWSIECRINAENPLKNFMPSAGRVDMYL
PPGGLGVRVDSAMYSGYTIPPYYDSMVAKLITFADTREEAVAKMKRALDEFVVEGVFTTI
PFHLRLMDHEVFKSGDFNTKFLEKYDVMGS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaagtattgattgccaaccgcggcgaaattgccgtgcggatcatccgcgcc
tgtaaagagctcgatatccagaccgttgcagtttattcggaagcggacaaagaagcattg
catgttgaattggccgatgaagcgtattgcatcgggccgaagttatcaaaagacagctat
ttgaacttctccaacatcatcagcgtcgcaaaactgacgaattgcgacggcatccacccg
gggtatggtttcctcgctgaaaattcgagcttcgccgaattatgtgaagcgtgcgacatc
atgttcatcgggccgacagccgcagcgatctcgaaaatgggcacaaaagacgtcgctcgt
gagacgatgcgcgctgcaggcgttccggtcgttcccggctccaccgggattgtcggtagc
gaagaggaaggcttggagatcgccgagaaaatcggtttcccggtcatcatcaaggcgacc
gcgggaggcggcggcaaagggatccgcgtagcgagaacacgcgaagatttcatcaaaggc
ctgaacatgacacagaaagaagcggcagcagcgttcggcaacccaggcgtctatatcgag
aaattcatcgaggatttccgccatatcgaaatccaggtgctggccgattcgcatggcaat
gccatccatctgggcgaacgggattgctcgatccagcgccgcatgcaaaaactcgtcgaa
gaagcaccatctccggccttgtcggaagaattgcgtgctgaaatgggcgaggcggccgtt
aaagcggcgcaggcggtcaattatcgcggtgccggcacagtcgaattcatcttcgatgtc
gaaaaccagaaattctatttcatggagatgaatacgcgcatccaggtcgaacacccggtc
accgaaatgatcacgggcatcgatttgatccaacagcaattgaaagtcgcttccggcgaa
acgctcgcctacaaacaggaagatgtgacgttcaagggctggtcgatcgaatgccgcatc
aacgccgaaaacccgctcaagaacttcatgccttctgcagggcgtgtggatatgtattta
ccgccgggcggcctaggcgtacgcgtcgattccgccatgtattcgggctatacgatcccg
ccttattatgattcgatggtggccaagctgatcactttcgccgatacacgcgaggaagca
gtggccaagatgaaacgtgcacttgatgaatttgttgtcgagggtgtcttcacgaccatt
ccattccatctgcgcctcatggatcacgaggtgttcaaatccggggacttcaacacaaaa
ttcctggaaaaatatgatgtaatgggctcctga

DBGET integrated database retrieval system