KEGG   Planococcus plakortidis: BBI15_05845Help
Entry
BBI15_05845       CDS       T04812                                 

Definition
(GenBank) inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
ppla  Planococcus plakortidis
Pathway
ppla00521  Streptomycin biosynthesis
ppla00562  Inositol phosphate metabolism
ppla01100  Metabolic pathways
ppla01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ppla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BBI15_05845
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BBI15_05845
Enzymes [BR:ppla01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     BBI15_05845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: ANU19764
UniProt: A0A1C7E713
LinkDB All DBs
Position
complement(2050245..2051042)
Genome map
AA seq 265 aa AA seqDB search
MDQHAMDRYIKSMIKEAGHRIRNSFLSDISVDTKAHANDLVTNVDKEVEKFFIHHIREDF
PAHRVFGEEGFGDTIEELSGTVWMLDPIDGTMNFVHQRRNFAISLGIYEDGVGKMGYIYD
VVNDDLYHAIAGGGAYYNDERLQPLLETDISESIVGMNAMWATPNRHVEHEATIRLVHEA
RGMRSYGSAALELAYLASGRIDAYISMRLSPWDIAGGLVMAKEVGAVASNFSGEPANLLK
SDTFVAANPSIHGKLLQEYIKPKRT
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggaccagcacgcaatggaccgttacataaaatcgatgatcaaagaagcagggcaccgg
atccgcaattcatttcttagcgacatctcggtggatacgaaagcccacgccaatgacttg
gtcaccaacgtggacaaggaagtggagaagtttttcatccaccatatccgggaagatttt
ccggcccaccgcgtttttggcgaagaaggatttggggacacaatcgaagaattaagcggc
acggtatggatgctcgacccaatcgatggcaccatgaatttcgtgcaccaacgacgcaat
tttgccatttcactcggtatttatgaagatggtgtcgggaaaatgggttatatctatgat
gtcgtcaatgacgatctatatcatgcgatcgcaggcggtggtgcttattataatgatgag
cgtttgcagccgcttttggagacggacatcagcgaatcgatcgttggcatgaacgccatg
tgggcgacgccgaaccggcacgtggagcacgaagccaccatccgccttgtacacgaggcg
cggggcatgcgttcgtatggttctgcagcgctggagctcgcgtatcttgcaagcgggcgc
atcgacgcctatatttccatgaggctgtcgccctgggatatcgcaggcggtttggtgatg
gcaaaagaagtcggggctgtcgcaagcaatttctcaggcgaacctgcgaacttgctgaag
tcggatacattcgtcgccgctaacccgtccattcacggaaaattgctccaggaatacatt
aagccgaagcgcacctga

DBGET integrated database retrieval system