KEGG   Planococcus plakortidis: BBI15_08940Help
Entry
BBI15_08940       CDS       T04812                                 

Definition
(GenBank) Hsp33 family molecular chaperone
  KO
K04083  molecular chaperone Hsp33
Organism
ppla  Planococcus plakortidis
Brite
KEGG Orthology (KO) [BR:ppla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ppla03110]
    BBI15_08940
Chaperones and folding catalysts [BR:ppla03110]
 Heat shock proteins
  HSP33
   BBI15_08940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: ANU20332
UniProt: A0A1C7EA82
LinkDB All DBs
Position
complement(2701608..2702477)
Genome map
AA seq 289 aa AA seqDB search
MNDYLVKALAYDGQIRAFAARTTETVNEAQRRHYTWPTASAALGRSMTASVMLGAMLKGE
EKLTIKINGGGPLGTILVDANAKGEVRGYVSNPQTHFDLNEQGKLDVRRAVGTEGTLTVS
KDIGLQHPYVGQVPIVSGELGDDFTHYIVTSEQTPSSVGVGVIVNPDNTILASGGFIIQL
MPGTDETVISQLEQRLAEIPTISNMVRAGLTPEDILDEVLGKENVKALDTMPVNFQCQCS
RERIHNAIRGLGSEEIEDMIVTDGQAEAQCHFCNETYLFTKDQLQDMLS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaatgattatttagtgaaagcattggcttatgatggccaaatccgggccttcgccgcg
cgcacgacagaaaccgtgaatgaggcgcagcgccgccattacacgtggccgactgcctct
gctgcactgggccgttctatgacagcgagtgtcatgctcggcgcgatgctgaaaggcgag
gagaaattgacgatcaaaatcaatggaggcggcccgcttggcacgattctcgttgatgcc
aacgctaaaggcgaagtgcgtggctatgtttccaacccccaaacgcattttgacttgaac
gaacaaggcaaactcgatgtccgccgggcagttgggacagaagggacactgactgtctcc
aaagatatcggtttgcagcatccgtatgtcggccaagtgccgatcgtctccggggagctt
ggcgatgattttacccattacatcgtgacttctgaacagacgccttcttctgttggcgtc
ggcgttatcgtcaatcccgacaataccatcttggcttcaggtggcttcatcatccaattg
atgccgggcactgatgaaaccgtaatcagccagcttgaacagcgcctggccgaaatcccg
accatttccaatatggtgcgtgccggcttgacgcctgaggatattctcgatgaagtattg
ggcaaagaaaatgtcaaagcgcttgatacgatgccggtgaatttccaatgccaatgctcg
cgtgagcgcatccacaacgccatccgggggcttgggtccgaggaaatcgaagacatgatc
gtgacagatggacaggcggaagcacaatgccatttctgtaacgaaacctatctgttcacg
aaagaccaattgcaggacatgttgtcctga

DBGET integrated database retrieval system