KEGG   Planococcus plakortidis: BBI15_11420Help
Entry
BBI15_11420       CDS       T04812                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppla  Planococcus plakortidis
Brite
KEGG Orthology (KO) [BR:ppla00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BBI15_11420
Enzymes [BR:ppla01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BBI15_11420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO AlaDh_PNT_C Thi4 FAD_binding_3 NAD_binding_8 Glutaredoxin K_oxygenase Thioredoxin_4 FMO-like Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ANU20779
UniProt: A0A1C7EAK8
LinkDB All DBs
Position
3211063..3212610
Genome map
AA seq 515 aa AA seqDB search
MILDAQIKAQLKQYLQLLEGDVLLQVSAGSDKVSTDMIDLVEELSAMSPRIQMERAELER
TPSFSVTRPGEDMGITFAGIPLGHEFTSLVLALLQVSGRAPKADPKTMDQIKALDGTYHF
ESYISLSCQNCPEVVQSLNLMSVLNPNITHTMIDGAAFKEEVESKDIMAVPTVFLNGESF
SSGRMSLEELLAKLGSAPDASEFEGKEPFDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTLSIENFVSVKHTEGPKFAASLEEHVKEYDIDLMNLQRAKRLEKKDLFELELE
NGAVVKGKTVILSTGARWRNIGVPGEEEFKNKGVAYCPHCDGPLFAGKDVAVIGGGNSGV
EAAIDLAGITNHVTVLEYNAELKADSVLQDRLKSLPNVTVLTNARTQEITGTDKVNGISY
IDLQTGEEKHVELSGVFVQIGLVPNTDWLGDFVERTPHGEIVIDQRGATNMPGVFAAGDC
TNIPYKQIIISMGSGATASLSAFDHLIRSDIPVLV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgatactagatgcgcaaatcaaagcacaattaaagcaatacttgcagctattggaaggc
gacgtgctgctccaagtgagtgccggatccgataaggtatcaaccgatatgatcgatttg
gtggaagaactatccgccatgtctccgcgcattcaaatggagcgcgcggagctcgagcgc
acgccgagctttagcgtcacccgccctggcgaagatatgggcatcacgttcgccggcatc
ccgctcggccacgagttcacgtcactcgtacttgctttgcttcaagtgagcgggcgggcc
ccgaaagccgacccaaaaacgatggaccaaatcaaagcgctcgacggcacgtatcacttc
gagtcgtatatcagcctgagctgccagaactgcccggaagtcgtgcaatcactcaatttg
atgagcgtcctcaacccgaatatcacgcacacgatgatcgacggcgctgcattcaaagaa
gaagttgaaagcaaagacatcatggccgttccgacagtcttcttgaacggcgaatcgttt
tcaagcggtcgcatgtcgcttgaggaattgctggcaaaactcggcagcgcaccggatgcg
tccgaattcgaaggcaaagaaccgtttgacgtgctcgttgtcggcggcgggccggctggt
gccagcgcggcgatctatgcggcgcgtaaaggtatccgcaccggcatcgtcgcggagcgt
ttcggcggccaggtgatggataccttgagcatcgagaacttcgtcagcgtcaagcatacg
gaaggcccgaaatttgcggccagcctcgaagagcatgtgaaggaatacgacatcgacctc
atgaacctgcagcgtgcgaaacgcttggagaaaaaagatttgttcgagcttgaacttgaa
aacggcgctgtcgtcaaaggcaagaccgtcattctctcgacaggagcccgctggcgcaac
atcggcgtccctggcgaagaagaattcaagaacaagggtgttgcgtattgcccgcattgc
gacggcccgctatttgccggcaaagacgtcgcggtcatcggcggcggcaactccggcgtg
gaagcggcgatcgaccttgcaggcatcacgaaccacgtgacggtgctggaatacaacgca
gagcttaaagcggattccgttttgcaggaccgcctgaagagcttgccgaacgttacggtc
ttgacgaatgcccgcacacaggaaatcaccggcaccgataaagtgaacggcatttcctat
atcgacctccaaaccggcgaagaaaagcatgtcgaactatccggcgtcttcgtccaaatc
ggcctcgtgccaaacaccgactggctcggtgacttcgttgagcgcactccgcacggcgag
atcgtcatcgaccagcgcggcgccacgaatatgccgggcgtgttcgcggcaggcgactgc
acgaacatcccatacaagcagatcatcatttcgatgggctctggcgcgacggcttcactg
agcgcgttcgaccatctcatccgaagcgatatccctgttttggtgtaa

DBGET integrated database retrieval system