KEGG   Planococcus plakortidis: BBI15_12270Help
Entry
BBI15_12270       CDS       T04812                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ppla  Planococcus plakortidis
Brite
KEGG Orthology (KO) [BR:ppla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ppla03012]
    BBI15_12270
   03029 Mitochondrial biogenesis [BR:ppla03029]
    BBI15_12270
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ppla04147]
    BBI15_12270
Translation factors [BR:ppla03012]
 Eukaryotic Type
  Elongation factors
   BBI15_12270
 Prokaryotic Type
   BBI15_12270
Mitochondrial biogenesis [BR:ppla03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BBI15_12270
Exosome [BR:ppla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BBI15_12270
  Exosomal proteins of breast cancer cells
   BBI15_12270
  Exosomal proteins of colorectal cancer cells
   BBI15_12270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ANU20910
UniProt: A0A1C7EAK2
LinkDB All DBs
Position
126064..127251
Genome map
AA seq 395 aa AA seqDB search
MGKAKFDRSKTHANIGTIGHVDHGKTTLTAAIATVLARASGGEARSYDQIDNAPEEKERG
ITINTSHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHI
LLSRQVGVPYLVVFMNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDIPVIKGSALKALE
GEPEWEEKILELMAAVDEYIPTPERDTDKPFMMPVEDVFSITGRGTVATGRVERGQIKVG
DNVDIIGLTEEPKSTTVTGVEMFRKLLDYAEAGDNIGALLRGISRDDVQRGQVLAKPGSI
TPHTNFKAEVYVLSKEEGGRHTPFFTNYRPQFYFRTTDVTGVCNLPEGVEMVMPGDNIEM
DVELISPIALEEGTKFSIREGGRTVGAGVVASIQK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagctaaatttgaccgttctaaaacacacgctaacattggtacaatcggacac
gttgaccatggtaaaacaactttgactgcagcaatcgctacagttcttgctagagcatca
ggcggggaagctcgttcttacgaccaaatcgataacgcacctgaagaaaaagagcgcggt
atcacaatcaacacttctcacgtcgagtacgaaactgaaacacgccactatgcacacgtt
gactgcccaggtcacgccgactatgttaaaaacatgatcactggtgctgcacaaatggac
ggcgggatcctagtagtatctgctgctgacggcccaatgccacaaactcgtgagcacatc
ttgctttcacgtcaagtaggcgtaccttaccttgtagtattcatgaacaaatgcgacatg
gtagacgacgaagagcttcttgaactagttgagatggaagttcgtgacctattgtctgaa
tatgacttccctggcgatgacatcccagtcatcaaaggttctgcgcttaaagcccttgaa
ggcgagccagaatgggaagaaaaaattcttgagttgatggctgcagttgacgagtacatc
ccaactccagaacgcgacactgacaagccattcatgatgccagttgaggacgtattctca
atcactggccgtggtacagtagcaactggccgtgttgagcgtggacaaatcaaagtcggc
gacaacgttgacatcatcggtcttactgaagagccaaaatctacaactgttacaggtgta
gaaatgttccgcaaattgcttgactatgctgaagctggcgacaacatcggcgcacttctt
cgcggtatttcccgtgacgacgttcagcgtggacaagttcttgctaaaccaggctcaatc
actccacacacaaacttcaaagctgaagtttatgttctttcaaaagaagagggtggacgc
cacactccattcttcacaaactaccgtccgcagttctacttccgtacaactgacgtaact
ggtgtttgtaaccttcctgaaggcgtagaaatggttatgcctggcgataacatcgaaatg
gatgttgagctaatctctccaatcgcgcttgaagaaggtactaagttctctatccgtgag
ggtggacgtactgtaggcgctggcgttgtagcttctatccagaagtaa

DBGET integrated database retrieval system