KEGG   Paenibacillus polymyxa SC2: PPSC2_01885Help
Entry
PPSC2_01885       CDS       T01335                                 

Gene name
lig
Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
ppm03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ppm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    PPSC2_01885 (lig)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppm03400]
    PPSC2_01885 (lig)
Enzymes [BR:ppm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PPSC2_01885 (lig)
DNA repair and recombination proteins [BR:ppm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PPSC2_01885 (lig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ADO54370
UniProt: E3ECS6
LinkDB All DBs
Position
complement(442036..442986)
Genome map
AA seq 316 aa AA seqDB search
MKPVIPFEPELSEKVPVDVGLWRYEIKWDGTRILTYHDQGSTRLFNRKQHERTLLYPELA
HFSSYCRADSVILDGEMIALGADGKPSFHEIMRRDLIRRTDRIQAAYTAVPATYMLFDIV
YLNGEWVHRKPLQERLELLHQIIIPNERIQLAPAHPDGQALFQVMCSQGMEGIVCKKLDS
PYTLGGQDRRWVKVKNYGDIIAVIGGYTLNGGVINAVLLGQYDRQGMLRYIGHVGTGKLT
RGDWRQLTERLLPHTISERPFINKPDRHQDAFWVKPMFTAKIQYSEWRWQEGRTLRQPSI
QALVDQGIEQCIGPWK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgtcatcccgtttgaaccagaactgagcgaaaaagtccctgtagatgtaggc
ctttggcgttacgaaataaaatgggacggtacaagaattttaacgtatcacgatcagggc
agcacgcgtctgttcaatcgcaagcagcatgaacgaacgctattgtatccggagcttgcc
cacttctcctcctactgcagggcagattcagtcatactggacggggagatgatcgcactt
ggtgccgacggtaaaccgtcgttccatgaaattatgcgccgggatctgattcgccggacg
gatcgaattcaggcagcctatacagccgtacccgctacttacatgttgttcgatattgtt
tatctaaatggggaatgggttcatcgcaaaccgttacaggaaaggcttgaactgctgcat
cagatcatcataccgaatgaacggatccaactggctcccgctcatcctgatggacaagct
ctatttcaggttatgtgcagccaaggaatggaaggtattgtgtgcaaaaaactggatagt
ccatacacattgggcggacaggacagacgatgggtcaaggtcaaaaattatggtgatatc
attgccgttatcggtggctataccctaaacggaggcgttatcaacgctgtattgctgggc
cagtatgatagacaaggaatgctgcgctatatcgggcacgtggggacaggtaagctgact
cgtggagattggcgtcagctaaccgagcgcctcttgccacataccatatcggagcgacct
tttattaataaaccggatcggcatcaagacgcattttgggtaaagcccatgtttaccgcc
aagattcaatatagtgaatggcgatggcaagaaggacgtaccttgcgtcagccctccatc
caagctcttgtggatcaaggtattgaacagtgcatcggaccttggaagtga

DBGET integrated database retrieval system