KEGG   Paenibacillus polymyxa SC2: PPSC2_08305Help
Entry
PPSC2_08305       CDS       T01335                                 

Gene name
citC
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
ppm00020  Citrate cycle (TCA cycle)
ppm00480  Glutathione metabolism
ppm01100  Metabolic pathways
ppm01110  Biosynthesis of secondary metabolites
ppm01120  Microbial metabolism in diverse environments
ppm01130  Biosynthesis of antibiotics
ppm01200  Carbon metabolism
ppm01210  2-Oxocarboxylic acid metabolism
ppm01230  Biosynthesis of amino acids
Module
ppm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ppm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPSC2_08305 (citC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PPSC2_08305 (citC)
Enzymes [BR:ppm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     PPSC2_08305 (citC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADO55730
UniProt: E3EEP3
LinkDB All DBs
Position
1859678..1860973
Genome map
AA seq 431 aa AA seqDB search
MAKFEKFELPTEGEKITIDNGQLQVPNHPVIPFIEGDGTGRDIWKASKRVLDAAVEKAYN
GTKKIAWYEVFAGEKAFNTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFNGVPSPVKRPELVDMVIFRENTEDIYAGIEYAEGSEDVKKVIQFLQ
QELDVNKIRFPETSGIGIKPVSSEGSKRLVRAAIQYAVDHGRKSVTLVHKGNIMKFTEGA
FKNWGYEVAEQEFADKVFTWAQYDVIKEKEGEDAANAAQKAAEDAGKIIIKDAIADIALQ
QVLTRPSEFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKY
ADKDVVNPGSVILSGVMLLEHLGWKEAADLIYKGLETSINKKIVTYDFARLMDGATQVKC
SEFADTIISNL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatttgaaaagtttgagctcccaactgaaggcgaaaaaattacgattgataac
ggtcaactgcaggttccaaaccatccggtcattccgtttatcgaaggtgacggcacaggt
cgcgacatctggaaagcttccaagcgcgtactggacgcagctgtagaaaaagcatataac
ggcacgaaaaagattgcctggtatgaagtattcgctggtgagaaagctttcaatacatac
ggcgagtggctccctaacgatacgttggaagccatccgtgagtatattgtagccattaaa
ggtccacttacgacacctattggcggtggtatccgttcattgaatgtggcattgcgccaa
gaactggatttatacgtatgtctgcgtcctgttcgttactttaacggtgtcccgtctcca
gtaaaacgtcctgagttggtggacatggtcattttccgtgagaacacagaagatatctac
gcagggatcgaatatgccgaagggtccgaagacgtgaaaaaggtgattcagttccttcag
caagagctggacgtgaataaaatccgtttccctgaaacttcaggaattgggatcaagcca
gtgtcttccgagggttcaaagcgtctggtacgggcagctattcagtatgctgttgaccac
ggacgcaagagtgtaacgctcgtacacaaaggtaacattatgaaatttaccgaaggtgcc
ttcaagaactggggctatgaagtagccgagcaagaatttgcagataaagtatttacttgg
gcccagtatgatgtcatcaaggaaaaagaaggtgaggatgcggcaaatgcagctcaaaaa
gcagctgaagatgcgggcaaaatcattatcaaggatgcgattgctgatattgcacttcag
caggtgctgactcgtccttctgaatttgatgtcattgctacgctgaacctgaacggggac
tatctgtccgatgctcttgctgctcaagttggtggaattggtatcgcgccaggtgcaaac
attaactatgtaaccgggcatgctatctttgaagctacacatggtacagctccaaaatat
gctgacaaagacgtagtgaacccaggttccgtaattctgtccggcgtcatgctgctagaa
cacttgggttggaaagaagcagctgacctgatttacaaaggactggagacgtccattaat
aagaagattgtaacttatgactttgcccgtctgatggatggtgctacacaggtgaaatgc
tccgagttcgcggataccattattagtaacctgtaa

DBGET integrated database retrieval system