KEGG   Paenibacillus polymyxa SC2: PPSC2_20195Help
Entry
PPSC2_20195       CDS       T01335                                 

Gene name
npr
Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
ppm  Paenibacillus polymyxa SC2
Brite
KEGG Orthology (KO) [BR:ppm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ppm01002]
    PPSC2_20195 (npr)
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     PPSC2_20195 (npr)
Peptidases [BR:ppm01002]
 Metallo Peptidases
  Family M4: thermolysin family
   PPSC2_20195 (npr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP
Motif
Other DBs
NCBI-ProteinID: ADO58270
UniProt: E3E6L0
LinkDB All DBs
Structure
PDB: 

Position
4539762..4541540
Genome map
AA seq 592 aa AA seqDB search
MKKVWVSLLGGAMLLGSVASGASAESSVSGPAQLTPTFHAEQWKAPTSVSGDDIVWSYLN
RQKKSLLGVDSSSVREQFRIVDRTSDKSGVSHYRLKQYVNGIPVYGAEQTIHVGKSGEVT
SYLGAVVNEDQQAEATQGTTPKISASEAVYTAYKEAAARIEALPTSDDTISKDAEEPSSV
SKDTYAEAANNEKTLSVDKDELSLDQASVLKDSKIEAVEPEKSSIAKIANLQPEVDPKAE
LYYYPKGDDLLLVYVTEVNVLEPAPLRTRYIIDANDGSIVFQYDIINEATGTGKGVLGDS
KSFTTTASGSSYQLKDTTRGNGIVTYTASNRQSIPGTILTDADNVWNDPAGVDAHAYAAK
TYDYYKAKFGRNSIDGRGLQLRSTVHYGSRYNNAFWNGSQMTYGDGDGSTFIAFSGDPDV
VGHELTHGVTEYTSNLEYYGESGALNEAFSDVIGNDIQRKNWLVGDDIYTPNIAGDALRS
MSNPTLYDQPDHYSNLYRGSSDNGGVHTNSGIINKAYYLLAQGGNFHGVTVNGIGRDAAV
QIYYSAFTNYLTSSSDFSNARAAVIQAAKDLYGANSAEATAAAKSFDAVGVN
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtatgggtttcgcttcttggaggagctatgttattagggtctgtcgcgtct
ggtgcatctgcggagagttccgtttcggggccagctcagcttacaccgaccttccacgcc
gagcaatggaaagcacctacctcggtatcgggggatgacattgtatggagctatttaaat
cgacaaaagaaatcgttgctgggtgtggatagctccagtgtacgtgaacaattccgaatc
gttgatcgcacaagcgacaaatccggtgtaagccattatcgactgaagcagtatgtaaac
ggaattcccgtgtatggagctgaacaaactattcatgtgggcaaatctggtgaggtcacc
tcttacttaggagcggtggttaatgaggatcagcaggcagaagctacgcaaggtacaact
ccaaaaatcagcgcttctgaagcggtctacaccgcatataaagaagcagctgcacggatt
gaagccctccctacctccgacgatactatttctaaagacgctgaggagccaagcagtgta
agtaaagatacttacgccgaagcagctaacaacgaaaaaacgctttctgttgataaggac
gagctgagtcttgatcaggcatctgtcctgaaagatagcaaaattgaagcagtggaacca
gaaaaaagttccattgccaaaatcgctaatctgcagcctgaagtagatcctaaagcagaa
ctctactactaccctaagggggatgacctgctgctggtttatgtaacagaagttaatgtt
ttagaacctgccccactgcgtacccgctacattattgatgccaatgacggcagcatcgta
ttccagtatgacatcattaatgaagcgacaggcacaggtaaaggtgtgcttggtgattcc
aaatcgttcactactaccgcttccggcagtagctaccagttaaaagatacaacacgcggt
aacggaatcgtgacttacacggcctccaaccgtcaaagcatcccaggtaccattttgaca
gatgccgataatgtatggaatgatccagctggtgtggacgcccatgcgtatgctgctaaa
acctatgattactataaagccaaatttggacgcaacagcattgacggacgcggtctgcaa
cttcgttcgacggtccattacggtagtcgctacaacaatgccttctggaacggctcccaa
atgacttatggagatggagatggtagcacatttatcgccttcagcggggaccccgatgta
gtaggacatgaacttacgcatggtgtcacagagtatacttcgaatttggaatattacgga
gagtccggcgcattgaatgaagctttctcagacgttatcgggaatgacattcagcgcaaa
aactggcttgtaggcgatgatatttacacgccaaacattgcaggcgatgcccttcgctca
atgtccaatccaaccctgtacgatcaaccagatcactattccaacctgtacagaggcagc
tccgataacggcggtgttcacaccaacagcggtattatcaataaagcttactacttgtta
gcacaaggtggtaatttccatggcgtaactgtaaatggaattggccgtgatgcagcggtg
caaatttactacagtgcctttacgaactacctgacttcttcttccgacttctccaacgca
cgtgctgctgtgatccaagccgcaaaagatctgtacggggcgaactcagcagaagcaact
gcagctgccaagtcttttgacgctgtaggcgtaaactaa

DBGET integrated database retrieval system