KEGG   Paenibacillus polymyxa SC2: PPSC2_21120Help
Entry
PPSC2_21120       CDS       T01335                                 

Gene name
gatC
Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
ppm00970  Aminoacyl-tRNA biosynthesis
ppm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PPSC2_21120 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ppm03029]
    PPSC2_21120 (gatC)
Enzymes [BR:ppm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PPSC2_21120 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PPSC2_21120 (gatC)
Mitochondrial biogenesis [BR:ppm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PPSC2_21120 (gatC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: ADO58453
UniProt: E3EBC1
LinkDB All DBs
Position
complement(4719039..4719326)
Genome map
AA seq 95 aa AA seqDB search
MNISKEDVRHVARLSRLNLTENEEETMTGQLNAILHYAEKLNELDTEQVKPTTHVLHVSN
VMRDDEVRESLTHEQVMRNAPEEEDGQFKVPAVLE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgaacatttccaaggaagatgtccgtcacgtagccaggctgtcccggttgaatttgacc
gagaatgaggaagaaacgatgacagggcaattaaacgccattctccattatgcggagaag
ctgaatgagctggatacggagcaggtaaaaccgaccactcatgtgctgcacgtcagcaat
gtcatgcgggacgacgaagttcgcgaaagtttgacgcatgagcaagtgatgcgtaatgca
cctgaagaagaagatggacagtttaaagttcctgctgttctggaatag

DBGET integrated database retrieval system