KEGG   Paenibacillus polymyxa SC2: PPSC2_24270Help
Entry
PPSC2_24270       CDS       T01335                                 

Gene name
amyL
Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
ppm00500  Starch and sucrose metabolism
ppm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPSC2_24270 (amyL)
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PPSC2_24270 (amyL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 DUF1939
Motif
Other DBs
NCBI-ProteinID: ADO59117
UniProt: E3EBZ3
LinkDB All DBs
Position
5455330..5456823
Genome map
AA seq 497 aa AA seqDB search
MKRNHTMMQFFEWNVKADGSHWKKLARLAPELKAKGIDAIWIPPVTKGQSPEDTGYGVYD
LYDLGEFDQKGAVRTKYGTREDLLEAVASCVRHGVAVYVDLVMNHKAGADETEVFKVVEV
NPDNRNEVISEPFDIEGWTKFTFPGRQGKYSTFQWNFEHFNGTDYDASQDRTGIYRILGK
NKNWSDNVDDEFGNYDYLMFANIDYNHQDVRKEMIRWGKWLVDTLQCNGFRLDAIKHINH
EFVREFATEMIKKRGQDFYMVGEFWKPDLESCQKFLDTIDYKIDLFDVSLHYKLHSASLG
GKDFDLSTIFEDTLVHTHPLNSVTFVDNHDSQPHEALESWVEDWFKPSAYALILLRKDGY
PCVFYGDYYGIQGQTPVEGKQAELDPLLYARYHKAYGEQKDYFDDPHTIGWVRQGIPELH
GSGCAVVITNANDGEKRMFVGKQRAGEKWTDLTGHHDHTIKIEQDGYGIFPVRAGSVSVW
ALPTEEDSLDAEDTASA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaccatacgatgatgcaatttttcgagtggaatgtcaaagctgacggttct
cactggaaaaagcttgcccgcctggcaccggaactgaaggccaaaggaattgacgcgata
tggattccacctgtcaccaaaggccaatctcctgaggatacgggttacggcgtctatgac
ctttacgatctgggcgaatttgaccaaaaaggtgcagtgcgcaccaaatacggaaccagg
gaagacctgctggaagctgtcgcatcctgcgttcgccacggcgtagccgtctatgtcgat
ctggtcatgaaccataaggctggtgcggatgaaaccgaagtattcaaagtcgtcgaggtc
aacccggataatcgtaatgaggtcatttccgagccctttgatatcgaaggctggactaaa
tttacattccccggccgacaaggtaagtattccacatttcaatggaacttcgaacatttt
aatggaacggattacgatgcaagtcaggaccggacaggaatctatcgtattttaggtaaa
aacaaaaactggagcgataatgtagatgatgaattcggcaattatgattatttaatgttc
gccaatattgactataatcatcaggatgtgcgcaaggaaatgatccgctggggcaaatgg
ctggtggatactctacaatgcaacggattccgtctggatgcgatcaagcatattaatcat
gaatttgtacgagagtttgctacagaaatgattaaaaagcgtgggcaggatttttatatg
gtaggcgaattttggaaaccggatctagaatcttgccaaaagtttctggataccatcgat
tataaaatcgacctgtttgacgtatccctccactacaaactacatagcgcttccttgggt
ggtaaggatttcgatttaagcaccattttcgaggatacgctggttcatacccatcccctg
aactcggttacttttgtcgataatcatgattcccagccgcacgaagcgctcgaatcttgg
gtagaggactggtttaagcccagtgcctatgcactcatcctactgcgcaaagatggttat
ccctgcgtattctacggtgattactacggtatccagggacaaacgcctgtggaaggcaag
caggctgagctagacccgctcctatatgcccgataccacaaagcttatggtgagcaaaaa
gattattttgatgatccccatacgattggatgggttcgtcagggcattcctgagctacac
ggctctggatgtgctgtggtgatcactaacgcaaatgacggggaaaagcgcatgttcgtg
ggtaaacaacgtgcaggagaaaaatggaccgatttgaccgggcatcacgatcataccata
aagatcgaacaggatggctatggcatatttcccgttcgtgccggcagtgtatcggtatgg
gcacttcctactgaggaagacagcctggatgcagaggataccgcgagtgcttga

DBGET integrated database retrieval system