KEGG   Paenibacillus polymyxa SC2: PPSC2_24470Help
Entry
PPSC2_24470       CDS       T01335                                 

Gene name
amyB7
Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
ppm00500  Starch and sucrose metabolism
ppm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPSC2_24470 (amyB7)
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PPSC2_24470 (amyB7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_14 CBM_25 Alpha-amylase CBM53 Glyco_hydro_42 Cyc-maltodext_C hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ADO59158
UniProt: E3E7E7
LinkDB All DBs
Structure
PDB: 

Position
5499066..5502656
Genome map
AA seq 1196 aa AA seqDB search
MTLYRSLWKKGCMLLLSLVLSLTAFIGSPSNTASAAVADDFQASVMGPLAKINDWGSFKK
QLQTLKNNGVYAITTDVWWGYVESAGDNQFDWSYYKTYANAVKEAGLKWVPIISTHKCGG
NVGDDCNIPLPSWLSSKGSADEMQFKDESGYANSEALSPLWSGTGKQYDELYASFAENFA
GYKSIIPKIYLSGGPSGELRYPSYYPAAGWSYPGRGKFQAYTETAKNAFRTAMNDKYGSL
DKLNAAWGTKLTSLSQINPPTDGDGFYTNGGYNSAYGKDFLSWYQSVLEKHLGVIGAAAH
KNFDSVFGVRIGAKISGLHWQMNNPAMPHGTEQAGGYYDYNRLIQKFKDADLDLTFTCLE
MSDSGTAPNYSLPSTLVDTVSSIANAKGVRLNGENALPTGGSGFQKIEEKITKFGYHGFT
LLRINNLVNNDGSPTGELSGFKQYIISKAKPDNNGGTGNKVTIYYKKGFNSPYIHYRPAG
GSWTAAPGVKMQDAEISGYAKITVDIGSASQLEAAFNDGNNNWDSNNTKNYSFSTGTSTY
TPGNSGNAGTITSGAPSGANPGDGGGTTNKVTVYYKKGFNSPYIHYRPAGGSWTAAPGVK
MQDAEISGYAKITVDIGSASQLEAAFNDGNNNWDSNNTKNYLFSTGTSTYTPGSNGAAGT
IRTGAPSGSVLSVVTSTYATDLNEVTGPIQAEKLSGVSLNVSTSTYAPNSNGVEVTAQTE
APSGAFTPMDLGTLSNPTSLNTDWSKQSIYFIMTDRFSNGDPSNDNYGGFNSNNNDQRKW
HGGDFQGIIDKLDYIKNMGFTAIWITPVTMQKSEYAYHGYHTYDFYAVDGHLGTMDKFQE
LVRKAHDKNIAVMLDVVVNHTGDFQPGNGFAKAPFDKADWYHHNGDITGGDYDSNNQWKI
ENGDVAGLDDLNHENPATANELKNWIKWLLNETGIDGLRLDTVKHVPKGFLKDFDQAANT
FTMGEIFHGDPAYVGDYTRYLDAALDFPMYYTIKDVFGHDQSMRKIKDRYSDDRYYRDAQ
TNGVFIDNHDVKRFLNDASGKPGANYDKWPQLKAALGFTLTSRGIPIIYQGTEQGYSGGD
DPANRENMNFNANHDLYQYIAKLNNVRNNHPALQNGSQKEKWVDDSFYSFQRSKNGDEAI
VFINNSWNSQTRTIGNFDNLSNGTRLTNQLSNDSVQINNGSITVTLAPKEVKIFTK
NT seq 3591 nt NT seq  +upstreamnt  +downstreamnt
ttgaccttgtatcgaagtctatggaaaaaagggtgtatgcttctattaagccttgtgctg
tctctgaccgccttcattggctcaccctctaatacggcgagcgctgcggttgcagatgat
tttcaagcttccgttatgggaccgctggcgaaaatcaatgactggggttcctttaaaaag
cagctacaaacgttgaaaaacaatggcgtatatgccatcactaccgacgtctggtggggc
tatgtggagagcgcaggagataaccagttcgattggagttactacaaaacctatgcaaat
gccgtgaaagaagcgggactgaagtgggttcctatcatctcaacgcataagtgtggagga
aatgtaggagatgactgcaacatcccactgccaagctggctgtcgagcaaaggcagtgca
gatgaaatgcagttcaaggacgaaagcggctatgccaatagtgaagccctttccccattg
tggagcggaaccggtaaacaatatgacgagctgtatgcctcattcgctgaaaactttgcc
gggtataaaagtatcattcccaaaatttatttgagcggcggtccttccggggaattgcgc
tatccgtcctactatccagcagcagggtggagctacccgggacgaggcaagttccaagct
tatactgaaacagccaaaaatgcattccgcacagctatgaatgacaagtacggatcattg
gacaagcttaatgctgcttggggcaccaagcttaccagccttagccaaatcaatccaccg
accgacggggatggattttacacgaatggcgggtataattccgcgtatggaaaggatttt
ctgtcgtggtaccaaagtgtgcttgagaagcatctaggtgtcatcggagcagctgcccac
aaaaacttcgattctgtgtttggtgtccggatcggggccaaaatttccggtctgcactgg
caaatgaacaatcctgccatgccgcacggcacagaacaagcgggtggatattatgattac
aaccgtctcattcagaaattcaaggatgccgatctagacttgacatttacttgcctagag
atgagtgacagtggcacagcaccgaattattcgctgccgtccaccctggttgataccgtc
tcctccatcgcgaatgccaagggtgttcgcctgaatggtgaaaatgcacttccgacaggc
ggtagcggcttccaaaaaatcgaggagaaaatcacgaagttcggttatcacgggtttacg
ttattgcgcatcaacaatctcgtcaacaatgatggctcaccaaccggtgagttgagtgga
ttcaaacaatatatcatcagcaaagccaagcctgacaataatggcggtacaggcaacaaa
gtaacgatatactataaaaaaggcttcaactcgccttacattcactaccgtccggctggt
ggtagctggactgctgcacctggtgtgaaaatgcaggatgccgaaattagcggctatgct
aaaattaccgtcgatatcggttctgcctcccaattggaagccgcttttaacgacggcaat
aacaactgggacagcaacaacaccaaaaactactccttcagcacgggcacttctacgtac
acgcccggtaatagtggcaatgcaggaacgatcacttcaggcgctccatcgggtgcgaat
cccggggatggcggcggtacaactaacaaagtaacggtatactacaaaaaaggctttaac
tcaccttacattcactaccgtccggctggtggtagctggactgctgcacctggtgtgaaa
atgcaggatgccgaaattagcggctatgctaaaattaccgtcgatatcggttctgcctcc
caattggaagccgcttttaatgatggcaataacaactgggacagtaacaataccaaaaac
taccttttcagcactggaacttctacctacacgcccggctctaacggagccgcaggaact
atccgaacaggggcaccttccgggagcgtcctcagcgtagtgacttccacctacgcaacc
gacctcaacgaagttacaggacctatccaagcagaaaaactttcaggtgtatccttaaac
gtaagcacttctacctacgcacccaactctaacggagttgaagtaactgctcaaacggag
gcgccttcaggcgcctttacccctatggatttgggtaccctttccaaccccacttctctc
aacacagactggagcaaacagagcatttattttatcatgacagatcgtttcagcaacgga
gatccatccaacgataactacggtggcttcaattccaacaacaacgatcaacgcaagtgg
catggtggcgattttcaaggtattattgacaaactcgactacattaaaaatatgggcttt
accgcgatctggattaccccggtaacgatgcaaaagagtgaatacgcttaccacggctat
catacgtatgatttttatgcggttgacgggcatctcggaacaatggacaagttccaagag
ctggttcgcaaggcacatgacaaaaatattgctgtgatgctagacgtagtagtgaatcac
acaggtgattttcagccggggaacgggttcgccaaggctccttttgacaaagcagattgg
taccatcacaacggtgacattacagggggggactacgactccaacaaccaatggaaaatc
gaaaacggtgatgtagctggactggatgacttaaatcatgaaaaccctgctaccgccaac
gagcttaaaaactggatcaaatggctgcttaatgagacaggcatcgatggactgcggttg
gatactgtcaagcatgtaccgaagggttttctaaaggattttgaccaagccgccaatacc
ttcaccatgggtgaaattttccatggcgaccctgcttatgtgggggattacacccgatat
ctcgatgcagcactagattttccgatgtattatacaatcaaggacgtgttcggacacgat
caatccatgagaaaaatcaaggaccgctactccgatgatcgttactatcgtgatgctcag
actaacggtgtatttatcgacaatcatgatgtaaaacgtttcctgaatgacgcctctggc
aagccgggtgctaactatgacaaatggccacagctcaaagctgcattgggctttactctg
acgtcgcgtgggattccaattatctatcaaggcacagagcaaggctatagtggtggagat
gatcccgccaatcgggaaaatatgaatttcaacgccaaccatgacctgtatcagtacatc
gctaagctaaacaatgtgcgcaataaccaccctgctctgcaaaacggcagccaaaaggaa
aaatgggtggacgactccttttacagttttcagcgctctaaaaatggcgacgaggccatc
gtatttatcaacaactcctggaatagtcaaacccgcacgattggcaacttcgataatctg
tccaacggaacccgcctgactaaccagctgagcaacgactccgttcagattaacaacggt
tcgatcactgtgactcttgctccaaaggaagttaaaatcttcaccaagtaa

DBGET integrated database retrieval system