KEGG   Paludibacter propionicigenes: Palpr_0146Help
Entry
Palpr_0146        CDS       T01362                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ppn  Paludibacter propionicigenes
Brite
Enzymes [BR:ppn01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Palpr_0146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF4902
Motif
Other DBs
NCBI-ProteinID: ADQ78308
UniProt: E4T0E9
LinkDB All DBs
Position
complement(171118..171693)
Genome map
AA seq 191 aa AA seqDB search
MKFSLPELPYAHNALEPVISEKTISFHYGKHHQTYVNNLNGLVEGTEFENSDLESIVKKS
EGPIFNNAAQIWNHTFYFLTLTPNKGSVPSEKLAKAIDAAWGSLDNFKAEFNKAAVSVFG
SGWAWLVKDAEGKLSIVKESNAGNPITRGLTPLLTFDVWEHAYYLDYQNRRPDYVAALWD
LVDWKTVSERY
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcattgcccgaattaccttacgcacacaacgcactagaaccagtaatcagc
gagaaaacaataagttttcattatggaaaacatcatcaaacctatgtaaacaacctaaat
gggctagttgaaggaactgaatttgaaaattctgatctggaatcaatcgtaaaaaagtcg
gaaggtccgatattcaataatgcagcgcaaatctggaatcacacattttatttcctaacg
ctgacacccaacaaaggaagcgtaccaagcgaaaaactagcaaaagctatcgatgcagcc
tgggggtcgctggataattttaaagcagaattcaacaaagcggcagtatctgtattcggt
tcaggttgggcttggttggtaaaagatgctgaaggcaaattatctattgtaaaagaaagt
aacgccggcaacccaatcacacgtggattgactccacttcttacatttgatgtttgggaa
catgcctattatctcgattatcaaaatcgccgccctgattatgtggctgcgctctgggat
ttagtagactggaaaacagtttcggagagatattaa

DBGET integrated database retrieval system