KEGG   Paludibacter propionicigenes: Palpr_0531Help
Entry
Palpr_0531        CDS       T01362                                 

Definition
(GenBank) Carbamoyl-phosphate synthase L chain ATP-binding protein
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00061  Fatty acid biosynthesis
ppn00620  Pyruvate metabolism
ppn00640  Propanoate metabolism
ppn01100  Metabolic pathways
ppn01110  Biosynthesis of secondary metabolites
ppn01120  Microbial metabolism in diverse environments
ppn01130  Biosynthesis of antibiotics
ppn01200  Carbon metabolism
ppn01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ppn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Palpr_0531
   00640 Propanoate metabolism
    Palpr_0531
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Palpr_0531
Enzymes [BR:ppn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     Palpr_0531
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     Palpr_0531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_C Biotin_carb_N Dala_Dala_lig_C ATP-grasp RimK ATPgrasp_Ter ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ADQ78690
UniProt: E4T1U6
LinkDB All DBs
Position
647887..649383
Genome map
AA seq 498 aa AA seqDB search
MKKRLLIANRSEIAIRIIRAARKQGMLAVVFQSDREPDALYLNYADEIIPARDAGNDKPI
FLDPERIVNLALEHNIDLIHPGYGFLSENPDFAQLCVDNGINFIGPSPQLIRDMGLKTVA
KSMAIKSGLPLVPGSDGPVTDAHAAKAFADKIGYPVILKASAGGGGRGMRIVEKPETIER
NFKSASDEALAAFGNGDMFIEKYLQNPKHLEFQIMGDKHGNVVHLGERECSLQRKHQKIL
EEAPSASVTPAMRKEMGDMAVRFAKSIGYYSAGTIEFIMDEDGSYYFMEMNTRIQVEHPV
TEMITGVDLVDWQIRVALGEELTLKQEDIHIKGWAIECRVNTEDPQNRFSPQTGFIDKIY
FPQSKEIRIETGVQSGSVVTPYFDSMIAKIIVHGTDRADVIEKTLAALYDFSLIGLKTTV
PFCRTVLQHPEFVNATYTTRWVDSVFTPEMLENDEDEMIGALAATIMYASEYLQLSSDLP
TYKNDSLNVWVLNKRLNY
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacgacttttaattgccaatcgcagcgagatagctatacgcattattcgtgca
gcccgtaaacagggtatgttggctgtagtttttcaaagtgacagagagcccgatgctctt
tatctcaattacgccgacgaaattataccggctcgtgatgccggaaatgacaaaccgatt
tttctggatcctgaaagaattgtaaatctagcgttagagcacaatatagatttgattcat
cccggatacggttttttatccgaaaatcccgattttgcgcagctttgcgttgataacgga
ataaattttatcggtccttctccgcaattgattagagatatgggacttaaaactgttgca
aaaagcatggctataaaatccggattacctttggtgccgggcagcgatggtccggttacc
gatgcgcatgctgctaaagcttttgccgacaaaattggctatccggtcattcttaaagcc
tccgccggcggtggtgggcgaggcatgcgcattgttgaaaagcctgaaacaatagagcga
aattttaaatcggcatcggacgaagcattagcagcatttggtaacggtgacatgtttatt
gaaaaatacctgcaaaatccaaagcatttggaatttcagataatgggagataagcatggc
aatgtcgttcatttaggcgaaagagaatgttcattgcaacgtaagcatcagaaaatactc
gaagaagcaccttcagcaagtgtaacccctgctatgcgaaaagaaatgggcgacatggcg
gttcggtttgccaaatcaattggttattattctgctggtaccatcgagtttattatggac
gaagacggttcgtattattttatggagatgaatacccgtattcaggttgaacatccggtt
acggaaatgattacgggagttgacctggtcgattggcaaattcgcgtggcattgggcgaa
gaactgacactaaagcaagaagacattcacatcaagggttgggctatcgagtgtcgtgtg
aatacggaagatccccaaaaccgcttcagtcctcagacaggttttattgacaaaatttat
ttccctcaaagcaaagaaattcgcatagaaaccggagtacaatcaggttcggttgtaacg
ccatatttcgactcgatgatcgccaaaataattgtgcatggcaccgatcgtgccgatgtg
attgagaaaacactggcggcattgtacgatttcagtctgataggattaaaaaccaccgtt
cctttttgccgcacggtactacagcatcccgaatttgtaaatgctacctataccacccgt
tgggtcgattcggtatttactcctgaaatgcttgaaaatgatgaagatgaaatgataggt
gccttggctgctaccattatgtatgcatcagaatatctgcaactttcttcggacttgcca
acatataaaaatgactcgctcaatgtttgggtgctgaataagagattgaattattaa

DBGET integrated database retrieval system