KEGG   Paludibacter propionicigenes: Palpr_2354Help
Entry
Palpr_2354        CDS       T01362                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ppn  Paludibacter propionicigenes
Pathway
ppn00240  Pyrimidine metabolism
ppn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Palpr_2354
Enzymes [BR:ppn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Palpr_2354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK Ribosomal_L37e
Motif
Other DBs
NCBI-ProteinID: ADQ80487
UniProt: E4T6Z3
LinkDB All DBs
Position
complement(2858066..2858650)
Genome map
AA seq 194 aa AA seqDB search
MIYSERNHPIQQKRGSIEVICGSMFSGKTEELIRRLKRANFAKQRVEIFKPKIDTRYSED
EVVSHDKTAIRSTPVESSGSILLMSGDVDVIGIDEAQFFDEGLVDVCTQLANQGIRVIIA
GLDMDFKGVPFGPMPALCAIAEDVFKVHAICVRCGALAYVSHRLVDSDKRVLLGEMTEYE
PICRDCYNASKHQE
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatttattctgaaagaaaccatcccattcaacaaaaacgtggaagtatcgaagtgatt
tgcggctccatgttttccggcaaaacggaagagttgattcggcggttgaaacgagctaat
tttgccaaacaacgtgtagagatttttaaacctaaaattgacacgcgttactccgaagat
gaagtcgtttctcatgataaaacagcaattcgttctactccggttgagtcttcaggcagc
attttactcatgtcgggcgatgtagatgttattggcattgatgaagctcagttctttgac
gaagggttggtagatgtatgtacacaactggccaatcagggaataagagtcattatcgcc
ggtctggatatggattttaagggagttccgtttgggcctatgcctgccttatgcgccatt
gccgaagatgtttttaaagttcacgccatttgtgtgaggtgtggtgcattggcttacgtg
tcgcaccggcttgtagacagcgacaagcgcgtactgctgggcgaaatgactgaatacgaa
ccaatatgcagagattgttataacgcaagtaaacatcaagaataa

DBGET integrated database retrieval system