KEGG   Pandoraea pnomenusa DSM 16536: LV28_02205Help
Entry
LV28_02205        CDS       T03411                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K18369  alcohol dehydrogenase [EC:1.1.1.-]
Organism
ppnm  Pandoraea pnomenusa DSM 16536
Pathway
ppnm00640  Propanoate metabolism
ppnm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppnm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    LV28_02205
Enzymes [BR:ppnm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     LV28_02205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C ADH_N_assoc Sacchrp_dh_NADP NADH_4Fe-4S ThiF Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AIU25521
UniProt: A0A378YDS4
LinkDB All DBs
Position
2686115..2687152
Genome map
AA seq 345 aa AA seqDB search
MKALVFHGPQQISLEDRPMPEIQDPTDAIVRVLKTTICGTDLHILKGDVPTVEPGRILGH
EGVGEVVQTGNAVTAFKPGDRVLISCISSCGKCAACRRGMYSHCAAGGWILGNRIDGTQA
EYVRTPHADTSLYHAPDGVDDDALVMLSDILPTGFECGVLNGKVQPGSSVAIVGAGPIGL
AALLTAQFFSPAQIIVVDPDLARLEVATRFGATSVISPTREDAAEAVRRLTGGQGVDTAI
EAVGVPATFELCEAIVAAGGIIANVGVHGRKVDLHLESLWDRNISITTRLVDTAATPMLL
KTVASGRLTPGALITHHFSLADILNAYRTFGDAANTHALKVIIAP
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgctcgtatttcacggtccccaacagatatcgctcgaagatcggcccatgccg
gaaatccaggacccgaccgacgccatcgtgcgcgttctgaaaacgacgatatgcggcacc
gacctgcacatcctgaagggcgacgtgccgacggtcgagccgggccggatcctgggccac
gaaggggtcggggaggtcgtgcaaacgggcaacgccgtcacagccttcaagcccggcgac
cgggtgttgatctcatgcatctcgtcgtgcggcaagtgcgcggcctgccggcgcggcatg
tattcgcattgcgccgccggaggatggattctcggcaatcgcatcgacggcacccaggcc
gaatacgtcagaaccccgcacgccgacaccagcctttaccacgcgccggacggcgtggac
gacgacgcgctggtcatgctgagcgacattctgcccacgggcttcgaatgtggcgtgctc
aacggcaaggtgcaaccgggcagcagcgtggccatcgtcggggcgggaccgatcgggctc
gccgcgttgctcacggcgcagttcttcagcccggcccagatcatcgtcgtcgatcccgac
ctcgcgcggctggaggtggccacccgattcggcgccacctccgtgatctcgcccacaagg
gaagatgcggccgaggccgtcaggcgtctgaccggcgggcagggcgtcgacacggccatc
gaggcggtgggcgtacccgcgacattcgaactttgcgaggcgatcgtcgccgccgggggc
atcatcgccaacgtgggcgtgcacggccgcaaggtcgacctgcatctcgaatcgctgtgg
gacaggaacatcagcatcacgacccgtctggtcgataccgcggcaacgccgatgctgctc
aagaccgtggcctcggggcgtctgacgccgggtgcactgatcactcaccacttctcgctt
gccgatatcctgaatgcctaccggacgttcggcgatgcggccaatacacatgcgttgaag
gtcatcatcgcgccatag

DBGET integrated database retrieval system