KEGG   Pandoraea pnomenusa DSM 16536: LV28_06315Help
Entry
LV28_06315        CDS       T03411                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ppnm  Pandoraea pnomenusa DSM 16536
Pathway
ppnm00020  Citrate cycle (TCA cycle)
ppnm00480  Glutathione metabolism
ppnm01100  Metabolic pathways
ppnm01110  Biosynthesis of secondary metabolites
ppnm01120  Microbial metabolism in diverse environments
ppnm01130  Biosynthesis of antibiotics
ppnm01200  Carbon metabolism
ppnm01210  2-Oxocarboxylic acid metabolism
ppnm01230  Biosynthesis of amino acids
Module
ppnm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppnm_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ppnm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LV28_06315
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LV28_06315
Enzymes [BR:ppnm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LV28_06315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AIU26208
LinkDB All DBs
Position
complement(1758770..1761010)
Genome map
AA seq 746 aa AA seqDB search
MSTQQSSIIYTLTDEAPLLATGAFLPIIRTFTAPAGVAIETSDISVAGRILGEFPEFLTE
EQRVPDNLAELGRLTQDPDTNIIKLPNISASVFQLQSAIKELQSKGYKVPDYPEDPKTDE
EKAIQKRYSKCLGSAVNPVLREGNSDRRAPLAVKNYAKKHPHSMGEWSMASRTHVAHMKH
GDFYHGEKSMTIDKACDVRMELVTKSGKTIVLKPKVSLLDGEIIDSMFMSKKALCEFYEE
QMEDARKTGVMFSLHVKATMMKVSHPIVFGHAVKIFYKEAFEKHGKLFDELGVNVNNGLV
NLYEKIEALPSTQREEIIRDLHACHEHRPELAMVDSAKGISNLHAPNDVIVDASMPAMIR
LGGKMWGADGRPKDTKAVIPESTFARIYQEIINFCKTNGAFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFEIVEDGVANIVNIATGEVLLSQNVEAGDIWRMCQVKDAPIRDWVKLAVNRV
RNSGMPAVFWLDPYRPHEAELIKKVETYLKDHDTTGLDIQIMSQVRAMRYTLERVIRGLD
TISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLIEEN
HLRWDSLGEFLALAVSLEDLGIKTGNNRAKILAKTLDAATGKLLDNNKGPSPKTGELDNR
GSQFYLSMYWAQELAEQKEDAELAQRFAPLAKRLAENEKTIVAELAEVQGKPADIGGYYK
PDFDKLEQVMRPSKTFNAALASVATA
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgcagcaatccagcatcatctacaccctgaccgacgaagcaccgcttctggcc
accggcgccttcctcccgatcattcgcacgttcaccgcgccggccggcgtggcgatcgag
acgagcgacatctcggtggcaggtcgtatcctcggcgaattccccgaattcctgacggaa
gaacagcgcgtgccggacaacctcgccgagttgggccgcctcacgcaggatccggacacc
aacatcatcaagctgccgaacatcagcgcttcggtgttccagttgcagagcgccatcaag
gagctccaatcgaagggctacaaggtgccggactatccggaagacccgaagaccgacgaa
gagaaggccatccagaagcgctactcgaagtgcctgggctcggccgtgaacccggtgctg
cgcgaaggcaattcggatcgccgcgccccgctggccgtgaagaactacgccaagaagcat
ccgcacagcatgggcgaatggagcatggcttcgcgcactcacgtggcgcacatgaagcac
ggcgacttctaccacggcgaaaagtcgatgacgatcgacaaggcttgcgacgtgcgcatg
gaactcgtgacgaagagcggcaagaccatcgtgctcaagccgaaggtctcgctgctcgac
ggcgaaatcatcgacagcatgttcatgagcaagaaggcgctgtgcgagttctacgaagaa
cagatggaagacgcccgcaagaccggcgtcatgttctcgctgcacgtgaaggccaccatg
atgaaggtctcgcacccgatcgtgttcggccacgccgtgaagatcttctacaaggaagcc
ttcgagaagcacggcaagctgttcgacgaactgggcgtgaacgtcaacaacggcctcgtg
aacctgtacgagaaaatcgaggcgctgccgagcacgcaacgtgaagagatcatccgcgat
ctgcacgcctgccacgagcaccgtccggaactggcgatggtcgactcggccaagggcatc
tcgaacctgcacgcaccgaacgacgtgatcgtcgatgcctcgatgccggccatgatccgc
ctgggcggcaagatgtggggtgccgacggccgtccgaaggacaccaaggccgtgatcccg
gagagcacgttcgcccgcatttaccaggaaatcatcaacttctgcaagacgaacggcgca
ttcgacccgaccaccatgggcacggtgccgaacgtcggcctcatggcgcagaaggcagaa
gagtacggctcgcacgacaagacgttcgaaatcgtcgaagacggcgtggcgaacatcgtc
aacatcgccacgggcgaagtgctgctctcgcagaatgtagaagccggcgacatctggcgc
atgtgccaggtcaaggacgccccgatccgcgactgggtaaagctcgcggtgaaccgcgtt
cgcaactcgggcatgccggccgtcttctggctcgacccgtaccgtccgcacgaagccgaa
ctgatcaagaaggtcgagacgtacctgaaggaccacgacaccaccggcctcgatatccag
atcatgtcgcaagtgcgcgccatgcgttacacgctcgagcgcgtgatccgcggcctggac
accatttcggtgaccggcaacattctgcgcgactacctgaccgacctcttcccgatcatg
gagctgggcaccagcgccaagatgctgtcgatcgtgccgctgatggccggtggcggcatg
tacgaaacgggcgccggcggctcggcaccgaagcacgtcaagcaactgatcgaggagaat
cacctgcgttgggactcgctgggtgaattcctggcgctggccgtgtcgctggaagacctc
ggtatcaagacgggcaacaaccgcgccaagatcctcgccaagacgctcgacgcggcaacc
ggcaagctgctggacaacaacaagggcccgtcgcccaagaccggcgagctcgacaatcgc
ggcagccagttctatctgtcgatgtactgggcacaggaactcgccgagcagaaggaagac
gccgagctggcccagcgcttcgcgccgctggccaagcgactggccgagaacgagaagacg
atcgtggccgaactcgccgaagtacaaggcaagccggccgacatcggtggctactacaag
cccgacttcgacaagctcgagcaagtcatgcgcccgagcaagacgttcaacgccgcgctg
gcaagcgtcgcgacggcgtaa

DBGET integrated database retrieval system