KEGG   Pandoraea pnomenusa DSM 16536: LV28_12500Help
Entry
LV28_12500        CDS       T03411                                 

Definition
(GenBank) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
ppnm  Pandoraea pnomenusa DSM 16536
Pathway
ppnm00340  Histidine metabolism
ppnm01100  Metabolic pathways
ppnm01110  Biosynthesis of secondary metabolites
ppnm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppnm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    LV28_12500
Enzymes [BR:ppnm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     LV28_12500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH
Motif
Other DBs
NCBI-ProteinID: AIU27236
UniProt: A0A378YNZ1
LinkDB All DBs
Position
435524..435880
Genome map
AA seq 118 aa AA seqDB search
MNDTLERVAEVIASRKGGDPDKSYVARLFHKGDDAICKKIGEEATEVVLAAKDIRIGGAD
NLRQKLVNETADLWFHCMVLLAHHDLSPQEVLAELARREGLSGLVEKAQRGTRGEHAD
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatacgctcgagcgtgttgccgaagtcatcgcctcgcgtaaagggggcgatccc
gacaaatcgtacgttgcccgcctgttccacaagggcgacgacgccatctgcaagaagatc
ggcgaggaagcgaccgaagtcgtgctcgcggccaaggacatccgtattggcggcgccgac
aacctgcgtcagaagctcgtcaacgagacggccgacctgtggttccattgcatggtgctg
ctggcccatcacgatctgagcccgcaggaagtgctcgccgaactggcgcgccgcgaaggt
ctgtcgggtctcgtcgagaaggcgcagcgcggcacgcgcggcgaacacgccgactga

DBGET integrated database retrieval system