KEGG   Pandoraea pnomenusa RB38: DA70_03280Help
Entry
DA70_03280        CDS       T03067                                 

Definition
(GenBank) cellulose synthase
  KO
K00694  cellulose synthase (UDP-forming) [EC:2.4.1.12]
Organism
ppno  Pandoraea pnomenusa RB38
Pathway
ppno00500  Starch and sucrose metabolism
ppno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DA70_03280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ppno01003]
    DA70_03280
Enzymes [BR:ppno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.12  cellulose synthase (UDP-forming)
     DA70_03280
Glycosyltransferases [BR:ppno01003]
 Polysaccharide
  Structural polysaccharide
   DA70_03280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Cellulose_synt Glyco_trans_2_3 Glyco_transf_21 PilZ DUF2917
Motif
Other DBs
NCBI-ProteinID: AHN73580
LinkDB All DBs
Position
complement(2855032..2857689)
Genome map
AA seq 885 aa AA seqDB search
MIRDTLASVYKLGREIAARRLCVPHRPDGRPPGVVQWLLAATLRAPEHRLWITRRGDHVV
ARLAMRLDVRQLDQWRDWWLRALFQPPRSGRPDYPGRAFAWINERVTQRLDLPVDAGFWK
MVRALLWRRADRRPPFPPYSAWLAFRACNERARLWVVQTLFGIPPDTPAQLAHRFDKQLE
RVMAWRLTSTIVALFGLMGVFWIVTTPFDPFEQLLFSLCTLALALVFRRLDSQYSVLVLI
GLSLISTIRYVWWRLTQSLAFDTLPEAIVGYTLVAAEMYTWMILLFGYIQTVWPLHRRIT
PLPPDTRLWPSVDVYIPTYNEGLDVVRPTVYAACGIDWPPEKLNIYLLDDGRRDEMRRFA
EQAGVHYVTRADNRHAKAGNINHALGQTQGEFIAIFDCDHIPVRSFLQTTMGAFLKDERC
SLVQTPHHFFSDDPFERNLATRGAVPNEGRLFYGVVQDGNDFWNASFFCGSCAVLRRTAL
DEVGGVAVETVTEDAHTALKMHRRGWNTVYLKVVQAAGLATESLSGHVGQRIRWARGMAQ
IFRVDNPLFGRGLKFGQRICYANGMLHFFYGIPRIIFLLAPICYLFFGLHIVQAAALSIC
AYVLPHIAHANIANSRIQGKYRHSFWSDVYEAVLAWYVALPTTVAFINPRYGKFNVTAKG
GLIEQSFFDWSISKPYLVLLGFNLLGFLAGIVRYFYGPSGEGGALGFNLAWVTFNLAVLG
AAVAVATEVRQVRRTHRVTIRLPATLYLPDGRAMACHTRDFSGGGLALQLPVALNLTAGT
EAQVALTRGETEYGFPVSVVGARGHDLFLAFLPLTPEQDKHLVQFTFGRADAWRDWDAER
TRDEPIKALFEMLAMGLRGYQVLANYLLSKLVTRWQNRLRGARHT
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcgacacgctggcgtccgtgtacaagcttgggcgcgaaatcgcggcgcgtcgc
ctgtgcgtgccgcatcgaccggacggtcgcccgcccggtgtggtgcaatggctgctcgcc
gcgacgctgcgggcgccggaacaccgcctgtggatcacgcggcggggcgatcatgtcgtg
gcgcggctggccatgcggctcgacgtgcgccaactcgaccagtggcgcgactggtggctg
cgcgcactgttccagcccccgcgcagcggacggcccgactacccggggcgtgccttcgcg
tggatcaacgagcgcgtcacgcagcgactcgacctgcccgtcgacgcgggcttctggaag
atggtgcgggcgctgctgtggcgtcgcgcggaccggcgtccgccatttccgccgtactcc
gcgtggctcgcatttcgcgcctgcaacgaacgcgcgcggttgtgggtggtgcagacgctc
ttcggcattccgcccgacacgccggcacaactcgcgcaccgattcgacaaacaactcgag
cgcgtcatggcctggcgcctgacctccacgatcgttgcgctgtttgggctgatgggcgtg
ttctggatcgtgaccacgccgttcgatcccttcgagcagttgttgttctcgctgtgcaca
ctcgcgctggcactggtatttcgccgtctcgacagccagtactcggtgctggtgctgatc
ggcctgtcgctgatctcgacgattcgctacgtgtggtggcgcctgacgcagtcgctcgcg
tttgacacgctgcccgaggccatcgtcggctacacgcttgttgccgccgaaatgtacaca
tggatgatcttgctgttcggctacatccagaccgtctggccgttgcatcgccgtatcacg
ccgctgccgccggacacgcgcctctggccaagcgttgacgtctacattccgacctacaac
gaggggctcgatgtggtgcgcccgaccgtgtatgccgcatgcgggatcgactggccgccg
gagaaactcaacatctatctgctcgacgacgggcgtcgcgacgagatgcgtcggttcgcc
gagcaggccggcgtgcattacgtcacgcgagcggacaatcgccatgccaaggcgggcaat
atcaatcacgcgcttggccagacgcagggcgagttcatcgcgatcttcgattgcgatcac
atccccgtgcgctccttcctgcaaacgacgatgggcgcgtttctcaaggacgaacgttgt
tcgctcgtgcagaccccgcaccatttcttttccgacgatcctttcgagcgcaacctcgcc
acgcgcggtgcggtgccaaacgaagggcggcttttctatggcgtggtgcaggacggcaac
gacttctggaacgcgtcgttcttctgcggctcctgcgcggtgctgcgccgcacggcactc
gatgaagtcggtggcgtggccgtggagaccgtgacggaggacgcccatacggcgctcaag
atgcaccgtcgtggctggaataccgtgtatctgaaggtggtgcaggcggcggggctggcc
accgagtcgctctccgggcacgtggggcaacgcattcgttgggcccgcggcatggcgcag
atctttcgcgtggacaatccgctgttcgggcgcggcctgaagttcggccagcggatctgt
tacgcgaacggcatgctgcatttcttctatggcattccgcgtattattttcctgctcgcc
ccgatctgctacctgttcttcggtctgcacatcgtgcaggccgcggcgctgagcatttgc
gcctatgtcctgccgcacatcgcccatgcgaacatcgcgaactcgcgcatccagggcaaa
taccgtcattcgttctggtcggatgtctacgaggccgtactggcgtggtacgtggcgctg
ccgaccacggtcgcgttcatcaatccgcgctatggcaagttcaacgtgacggccaagggt
gggctgatcgagcagagcttcttcgactggagcatctcgaaaccctatctggtgctgctg
ggtttcaacttgctgggctttctcgccggcatcgtccggtacttctacggaccgtcgggc
gagggcggggccctggggttcaatctggcgtgggtgacgttcaacctggcggtgctcgga
gcggctgtcgcggtggcaacggaagtcaggcaggtacggcgcacgcaccgcgtgacgata
cgcctgcccgccacgctctatctgcccgacggccgcgcgatggcatgccacacgcgagac
ttctcgggcggcggtctggcgctgcaattgccggtagcgctgaacttgacggccggtacc
gaggcgcaggtggcgctcacgcgcggcgaaaccgaatacggctttccggtaagcgtggtc
ggcgcgcgaggacatgacctgttccttgccttcttgcctctcacgccggagcaggacaag
catttggtgcaattcaccttcgggcgtgccgacgcgtggcgcgactgggacgcggagcgc
acgcgcgacgagccgatcaaggcgcttttcgaaatgctggcgatgggcctgcggggctat
caggtgctggcgaactatttgctgagcaaactggtgactcgctggcagaatcgtctgcgc
ggcgcacgtcatacgtga

DBGET integrated database retrieval system