KEGG   Pandoraea pnomenusa RB38: DA70_06890Help
Entry
DA70_06890        CDS       T03067                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ppno  Pandoraea pnomenusa RB38
Pathway
ppno00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ppno00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    DA70_06890
Enzymes [BR:ppno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DA70_06890
Transporters [BR:ppno02000]
 Other Transporters
  Pores ion channels [TC:1]
   DA70_06890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_N_4 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: AHN74226
LinkDB All DBs
Position
2042816..2043472
Genome map
AA seq 218 aa AA seqDB search
MLKLYGFPISNYYNKVKVVLYEKGLSFEESESIPSQEEPLLQCSPLGKVPYLQTEHGYLA
ESQVICDYLDAAHPSPALFSADPWRQAKERELLTMLELHLELVVREVYTQAFFGGTVSEG
TRSRTEKLLRRNIAAFKRLAKFAPYVAGDTFTMVDIAAAIHLPILGMATQAVYGEDFLQA
AGIDWKAYAKLMAERESFQRMRAEQKAYQQAQKEKAAK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagctgtacggatttcctatcagcaactattacaacaaggtcaaggttgtgctg
tacgagaagggcctgtcctttgaggagtcggagtccattccgagccaggaagagccgctg
ctgcaatgctcgccgcttggcaaggtgccgtatctgcaaaccgagcatggctatctggcg
gaatcgcaggtgatctgcgattacctggacgccgcgcatccgtcgccggccttgttttcg
gccgatccgtggcgtcaggccaaggagcgcgaattactgacgatgctggaactgcatctg
gagttggtcgtgcgcgaggtgtacacgcaggcgttcttcggcggcacggtgtcggagggc
acgcgctcgcgcacggaaaagctgctgcgccgcaatatcgcggccttcaagcgtctggcg
aagttcgcaccctatgtcgcgggcgacactttcacgatggtggacattgcggcggccatc
catttgccgattctcggcatggcgacgcaagcggtgtacggcgaagacttcctgcaggcc
gccggcatcgactggaaggcttacgccaagctgatggccgaacgtgagtcgttccagcgc
atgcgtgcggagcagaaggcttaccagcaagcgcagaaggagaaagcggcgaagtaa

DBGET integrated database retrieval system