KEGG   Pandoraea pnomenusa RB38: DA70_09125Help
Entry
DA70_09125        CDS       T03067                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ppno  Pandoraea pnomenusa RB38
Pathway
ppno00250  Alanine, aspartate and glutamate metabolism
ppno00410  beta-Alanine metabolism
ppno00640  Propanoate metabolism
ppno00650  Butanoate metabolism
ppno01100  Metabolic pathways
ppno01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DA70_09125
   00650 Butanoate metabolism
    DA70_09125
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DA70_09125
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DA70_09125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ppno01007]
    DA70_09125
Enzymes [BR:ppno01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DA70_09125
Amino acid related enzymes [BR:ppno01007]
 Aminotransferase (transaminase)
  Class III
   DA70_09125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AHN74613
LinkDB All DBs
Position
1562044..1563336
Genome map
AA seq 430 aa AA seqDB search
MLNSARSNASLQARKDAACAKGIGVMTQHFTARARNAEIWDVQGNRFIDFAGGIAVLATG
HRHPRIVAAVQAQLEQFHHTCFHVTPYEGYVALCERLNDITPGKFAKKTALFTTGAEAVE
NAIKVARAATGRSAIIAFSGAFHGRTMMGMALTGKVAPYKQGFGPMPAEVFHAPYPVALH
GVSVDDSIAAIESLFKTDVDPRRVAAIFIELVQGEGGFYVAPPAFVTSLRALCDKHGILL
VVDEVQTGFARTGKPFALSHHDVDADLVTMAKSLAGGFPLSALTGRAELMDAAGPGGIGG
TYAGNPLACAAALAAIDVIEEEGLAERASVLGDQLTCVLAGLRAEVPGIVDVRGLGAMIA
VEFGDAGTGAPDADMTRRVQAEALRRGLLLLICGVHANVIRFLFPLTIEDEVFAEGLAVL
VESIRSARAA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgttgaattcagcccgcagcaacgcatcgcttcaggcgcgcaaggacgccgcctgcgcc
aaaggcattggcgtcatgacgcagcacttcacggcccgtgcccggaacgccgagatctgg
gacgtgcaaggcaatcgcttcatcgatttcgcgggcggcattgccgtgttggcgaccggt
catcgacaccctcgcatcgtggccgccgtgcaggcgcagctcgagcagtttcaccacacc
tgctttcatgtcacgccgtacgaggggtacgtggcgctgtgcgagcggctcaacgacatt
accccgggcaagttcgccaagaaaacggcgttgttcacgactggggccgaagcggtggag
aacgccatcaaggtagcgcgtgccgccacggggcgcagcgcgatcatcgctttctcgggc
gccttccacggtcgcacgatgatgggcatggcgctcacgggcaaggtcgcgccctacaag
cagggtttcgggccgatgccggcagaggtgtttcacgccccgtacccggtggccctgcac
ggggtgagcgtggatgacagcatcgccgcaatcgaatccctgttcaagaccgatgtcgat
ccgcgccgcgtcgccgccatcttcatcgaactggtgcagggcgaaggcggcttctatgtg
gcgcccccggctttcgtgacgagcctgcgcgcgttgtgcgacaagcacggcattctgctg
gtggtggacgaagtgcagacgggcttcgcgcgcacgggcaagccgttcgcgctgtcgcat
cacgatgtcgatgccgatctcgtcacgatggccaaaagccttgccggcggctttccgctt
tcggccctgaccgggcgtgccgagttgatggacgccgcgggcccgggcggcatcggcggc
acctatgcgggaaacccgctcgcttgcgccgctgcgctcgctgcgatcgatgtgatcgag
gaagaagggttggccgagcgtgcgtcggtgctgggcgatcagttgacctgtgtacttgcg
gggttgcgcgctgaggtgccgggcatcgtcgacgtgcgcggactcggcgccatgatcgcc
gtggagttcggcgatgcaggcactggcgcgccggacgccgacatgacgcgtcgcgtgcag
gccgaggcgctcaggcgcggtttgctgttgctcatctgcggggttcacgccaacgtcatc
cgcttcctcttcccgctcacgatcgaggatgaggtgttcgcagaagggctggcggtactc
gtcgaatcgattcgctcggcacgtgcggcctga

DBGET integrated database retrieval system